Джулиджана волшебные превращения: Julijana.SU — Волшебные превращения

Содержание

Время перемен » Julijana.SU

Ном де Плам

 

Время перемен

 

 

Часть 1

 

 

— Что за… — простонал я, перевернувшись и зарывшись лицом в подушку.

Ага, как же. Шум от включенного пылесоса всё равно настиг меня, хотя работал он этажом ниже.

— Что за блядская жизнь! — швырнув со злости подушку через всю комнату, я неохотно вылез из постели.

Едва взглянув на меня, не прекращая пылесосить, мама буркнула: «Доброе утро».

— Доброе, — прожёг я её взглядом. — Какого лешего ты затеяла уборку в 11 часов утра, чёрт возьми.

— Сынуля, а почему бы тебе ни пойти со своими проблемами куда подальше? — она выключила пылесос, и, скрестив руки на груди, уставилась на меня. — Ты не успел проснуться, а уже ворчишь.

— Ага, учитывая, что спал я всего лишь два часа. Есть, дорогая мамуля, такая вещь как работа в ночное время, — включив свет в ванной, напомнил я ей. — Я работал до восьми утра, домой припёрся в полдевятого и только в девять заснул.

Взяв тюбик с зубной пастой, закончил:

— А сейчас одиннадцать утра. Тебе это понятно?

— Ну, я, конечно, жутко извиняюсь, — протянула она. — Слушай, нам теперь всем планировать свои дела, учитывая тебя. Похоже, ты занял вакантное место Пупа Земли.

— Да иди ты со своими шутками, — я выдернул полотенце из ящика. — Неужто так трудно подождать пару часов с этим пылесосом.

— Ну, дорогой, дома должно быть чисто, — хмыкнула она. — А я не могу ждать весь день, пока ты валяешься в кровати

— Конечно, мам, это для тебя действительно непосильная задача. Гораздо проще весь день проиграть с подругами в бинго, дымя при этом как паровоз. Похоже, мысль о том, что можно заниматься чем-то ещё ты приравниваешь к восьмому смертному греху.

— Не смей со мной так разговаривать, — рявкнула она, выдёргивая шнур пылесоса из розетки. — Ты даже представить не можешь, сколько у меня работы днём.

— Извини. Неужели я что-то пропустил: сигареты, бинго, кофе, дневные телесериалы и подобная им херня.

Да, действительно, ты, мамочка, работаешь как Папа Карло.

Включив душ, я предложил:

— Устройся на настоящую работу днём, и ты поймёшь, что значит по-настоящему уставать. Хотя, вряд ли кто-нибудь захочет взять человека с неоконченным средним образованием.

С чувством победы, я захлопнул дверь ванной и забрался под душ, в шуме которого утонул ответ мамульки.

Как долго мне ещё мучиться со всем этим дерьмом? Я ненавидел жить в родном доме, но не мог себе позволить что-нибудь другое, пока не верну ссуду, взятую на обучение в колледже. Я не живу, а существую: колледж — пять дней в неделю, работа — три ночи плюс уик-энд, а в немногие свободные часы — корплю над домашними заданиями, а мамуля вечно всем недовольна. Правильно, она чуть ли не завидует тому, что я учусь в колледже. Сама-то школу бросила, когда залетела от одного парня, а вернуться ей мешала гипертрофированная гордость. Моя старшая сестра Гвен была абсолютно права, когда три года назад уехала от нас.

«Почему отец живёт с ней?» — подумал я, ожесточённо втирая шампунь в волосы. Десять процентов из их времени они с мамой разговаривают, сорок процентов — не замечают друг друга, а всё остальное время — ругаются между собой. И снова я пообещал себе, что, как только смогу, то непременно съеду отсюда.

 

 

— Куда это ты собрался? — маменька сидела на кухне с сигаретой, зажатой между пожелтевших от табака пальцев — это был один из её любимейших вопросов.

— Знаешь, — затянулась она. — Хотела бы я хоть денёк пожить твоей жизнью.

— М-да, если хочешь, — пожалуйста, — я покачал головой. — Думаешь, двенадцать часов на ногах, вкалывая на кучку ленивых засранцев из профсоюза это здорово, пожалуйста, вперёд и с песней.

Надев солнечные очки, я продолжил:

— Однако ты уверена, что я ни хрена не делаю.

— А ты попробуй как я: стирка, уборка, походы по магазинам и прочее, и посмотрим кому тяжелее.

— Да не вопрос, ма, — ухмыльнулся я. — Вот будут у меня каникулы, и я весь твой.

Докурив сигарету, мама зажгла новую и выдохнула:

— А не пошёл бы ты, сынуля, на хер.

— Я тоже люблю тебя, ма.

 

* * *

 

— Доброе утро!

— А? Что? — я вскочил, протирая глаза и озираясь по сторонам, пытаясь определить, сколько сейчас времени, однако, часов нигде не было.

— Подымайся, соня. Раковина полна немытой посуды, грязного белья до чёрта, а на пол без слёз не взглянешь.

— Слушай, это не смешно. Иди лесом, — заныл я, укладываясь обратно в койку. — У меня сегодня выходной, и надо быть идиотом, чтобы потратить его на твои чёртовы домашние дела.

— Нет-нет, это твои домашние дела, — её голос звенел от радости. — Теперь ведь ты стал мамочкой.

— Что? — я резко сел и огляделся по сторонам, возле постели стояла моя точная копия; поражённый, я закрыл глаза, подозревая, что просто ещё не проснулся.

— Вставай, мамуля, — хихикнула моя копия — блин, да это же мой собственный голос! — Я уезжаю, а когда вернусь вечером, то хочу увидеть вкусный ужин и чистый дом. Думаю, что папа хочет того же.

Неохотно я открыл глаза и обнаружил, что двойник всё ещё здесь.

— Что, чёрт возьми, происходит?

Отбросив одеяло, я выбрался из постели, едва не рухнув мордой в ковёр. Похоже, я здорово прибавил в весе. Посмотрел вниз и увидел, что за ночь у меня отросли здоровущие сиськи. В панике я сунул руку под ночнушку, которая была на мне (кто-нибудь знает, какая сволочь на меня её натянула?) и обнаружил между ног женский первичный половой признак.

— Ну, как нравится? — осведомилось Альтер эго. — Лучше чем те шлюшки, которых ты приводил домой, а?

Если бы я не был так напуган, то меня точно бы стошнило прямо на ковёр. Не обращая ни на что внимания, я ворвался в ванную. Включая свет, заметил, что ногти у меня покрашены розовым лаком и примерно в дюйм длиной.

— Чёрт, этого не может быть, — собрав остатки храбрости, я взглянул в зеркало — оттуда на меня смотрела моя мать.

Это было её тело, а я — моя сущность была внутри.

— Что это вообще за хуйня? — спросил я у зеркала, надеясь, что голос не выдает ужас, охвативший меня.

— Ущипните меня, — донеслось из-за двери. — Но мне это нравится. Всё, что мне известно — это то, что проснулась я в твоём теле. И я планирую увлекательно и небесполезно провести сегодня свой выходной.

Громко рассмеявшись, она добавила:

— Извини, но бинго сегодня тебе не светит, а дома полно работы, поэтому скучать не придётся. Пока.

 

 

Потеряв дар речи, я тупо стоял и пялился в зеркало. Дрожащей рукой я ощупал одну грудь и простонал от удовольствия, когда мои холодные пальцы наткнулись на набухший сосок.

«Неужели мне это нравится?» — подумал я, ещё более испуганный, чем раньше. Потом другой рукой я нащупал влажный холмик у себя между ног, и, сунув в щель палец, понял, что мне всё больше и больше это нравится.

— Да, пошла она в жопу. У нас обоих будет сегодня выходной.

Я засунул в свою новообретённую письку второй палец и улыбнулся.

 

* * *

 

Стоя под горячим душем, омывавшим моё новое тело, я намылил руки и тщательно исследовал его. Уделяя особое внимание грудям, благодаря которым маман в своё время получила место барменши и влагалищу, давшему жизнь двум детям — мне и сестре, я почти кончил.

Чёрт, у женщин столько способов доставить себе удовольствие — это просто нечестно. Однако маменька едва ли этим. Облазив её спальню, я обнаружил, что у неё нет ни секс-игрушек, ни порножурналов или кассет, ни эротического белья. Добавив к этому тот факт, что по пальцам одной руки можно посчитать, сколько раз они с папашей трахались в этом году, мне стало ясно, что своим телом она просто пренебрегает. Ладненько, тогда мы оторвёмся на полную катушку. Не исключено, что сегодня вечером маман прославится на всю округу как последняя шлюха. Это будет даже забавно. По крайней мере, для меня.

Внимание! У Вас нет прав для просмотра скрытого текста.

 

 

— Здравствуйте, могу я вам чем-нибудь помочь?

— Да, — запуская правую руку в сумочку, я поинтересовался у продавщицы. — Где у вас вибраторы.

Она показала мне стойку возле дальней стены и принялась объяснять достоинства наиболее популярных моделей. Я рад был отвлечься, потому что чувствовал себя не вполне комфортабельно в женском платье, кроме того, меня одолевали сомнения по поводу, а правильно ли я использовал косметику, а при взгляде на сумочку, болтающуюся на руке начинал чувствовать себя вообще полным идиотом. Проявив неподдельный интерес к предмету продажи, я пытался задавать самые грязные, самые интимные вопросы, что только мог придумать. Может быть, может быть маменьке это аукнется.

Надеясь, что на маменькиной кредитке есть деньги, я выбрал самое длинное и толстое дилдо, самый мощный вибратор, пару батплагов, «шарики удовольствия» и массажёр для клитора в форме бабочки.

— Это всё?

— О, конечно, нет, — я шмякнул сумочку на прилавок. — Есть ли у вас такое бельё, в котором самая добропорядочная домохозяйка почувствует себя стопроцентной шлюхой?

Начав с трусов с разрезом в промежности, она продемонстрировала мне прозрачное бельё, кружевное, кожу, латекс и всякие разные штучки-дрючки. Я выбрал с дюжину разных трусов, лифчиков, корсетов, а также наручники, шарообразный кляп, несколько масок и хлыст.

Было бы не плохо поэкспериментировать с этим днём, но когда папаша «случайно» найдёт мой комплект для «раскованной, свободомыслящей женщины», мамульку ждёт чёртова уйма неприятностей.

Пропустив мою (мамину) кредитку через терминал, продавщица спросила меня:

— А вы знаете, как пользоваться всем этим?

Она клеится ко мне? Маменька повела бы себя довольно определённо — она терпеть не могла лесбиянок, с тех пор как моя сестра привела домой свою первую подружку, — выскочила бы из магазина, плюясь от отвращения. Назло ей, я ответил:

— Вообще-то нет.

И изобразив жутко кокетливую улыбку, продолжил:

— Очень жалко, что вы не проводите инструктажа.

Сверкнув превосходными зубами в ответной улыбке, она перегнулась через прилавок и стала лениво теребить левый сосок через блузку.

— Знаете, — продавщица ухмыльнулась. — У меня сейчас как раз будет перерыв на ленч, и если хотите, то я смогла бы вам помочь.

Я вернул ей улыбку и нагло ухватил её за другой сосок:

— С удовольствием.

 

 

«Чёрт, уже четыре часа дня», — на изучение основ лесбийских удовольствий ушло больше времени, чем я планировал. Но мне не было жаль ни одной секунды, продавщица Эйприл, которой было двадцать с хвостиком, проявила недюжинный для её возраста опыт. Поглаживая сумочку, я усмехнулся, представив, как папенька посмотрит плёнку, где его жёнушка занимается этим с женщиной. Что он скажет, когда увидит мать своих детей в чёрном корсете и в наручниках, с торчащей в заднице рукояткой хлыста, а другая женщина, с пристёгнутым к бёдрам дилдо, в это время от души обрабатывает её? Сблюёт он или спустит, услышав, как его фригидная супружница визжит от удовольствия и умоляет свою случайную любовницу сильнее трахать её?

Убедившись, что кассета надёжно спрятана под сиденьем, я решил сделать с неё копию, прежде чем подсунуть эту плёнку фатеру. Понятия не имею, как он отреагирует, но позволить ему уничтожить единственное доказательство маменькиного распутного нрава я не могу. Кроме того, это любительское видео всегда можно будет посмотреть, когда мне вздумается погонять шкурку. Да и вообще, вдруг я захочу пошантажировать маман.

Жаль, что я не мог провести больше времени изучая свои обновки, но качество консультаций Эйприл с лихвой возместило это недостаток. Решив перекусить, я подъехал к «Макдональдсу», сунул руку под юбку и включил маленький вибратор, который Эйприл оставила мне в пизде на память. Когда подошёл парнишка-официант, принесший мой заказ: гамбургер и картошку-фри, я как раз кончал, так что юноше было обеспечено отличное шоу.

 

 

— Как день прошёл? — поинтересовалась мамулек. — Смотрю, к домашним делам ты даже и не притронулся. Выходит нашёл, чем себя развлечь.

— Вроде того, — ответил я. — Не торопись, через пару дней сама всё узнаешь.

— Да, ну ты, возможно, тоже скоро обнаружишь пару сюрпризов, когда вернёшься в своё обычное состояние.

Я пожал плечами: чтобы она не сделала, это не идёт ни в какое сравнение с моими сегодняшними проделками. С улыбкой я сказал ей:

— Ладно, всё было очень забавно, но, думаю, пришло время заканчивать игру.

— И чего ты хочешь от меня? — она откинулась в кресле и закурила, отравляя мои лёгкие никотином.

— Эй, — нахмурился я. — Вытащи эту гадость из моего рта и поменяй наши тела обратно.

Мама покачала головой и сделала глубокую затяжку.

— Если б я знала как.

Подтянув штаны, в плохой пародии на мачо с Дикого Запада, она сказала:

— Может быть, всё изменится, когда ты проснёшься. А я должна идти на работу.

О, чёрт. Она собирается сделать так, чтобы меня уволили! Она же и понятия не имеет, чем я занимаюсь.

— Ты не можешь это сделать, — сказал я ей. — Позвони и скажи, что заболела, пожалуйста.

— Извини, но я хочу полностью почувствовать себя Карлом, — она уже собралась уходить, но вдруг повернулась и издевательски улыбнулась. — Кстати, наверно, я должна тебя предупредить…

— Предупредить, о чём?

— Ну, у меня со дня на день начнутся месячные, так что, вероятно, твой отец захочет меня, то есть тебя, сегодня ночью трахнуть.

— Обломается, — заявил я. — Скажу, что у меня болит голова или что-нибудь в этом роде.

Всё ещё улыбаясь, она закончила:

— Если наберёшься смелости, сделай ему минет. Обычно этого твоему отцу хватает на всю ночь. Иначе он трахнет тебя, будет тискать сиськи, покусывать соски. Он довольно груб в постели.

— Пожалуйста, мам, хватит, — определённо это было слишком даже для сегодняшнего дня извращений. — Извини, что нахамил тебе. Я очень об этом сожалею.

— Я уже сказала тебе, что ничего сделать не могу, — не говоря больше ни слова, она повернулась и поспешила вниз, оставляя меня наедине с моим кошмаром.

Сглотнув неожиданно возникший в горле ком, я понял, что должен всё сделать для того, чтобы у моего старика сегодня ночью не встал.

 

* * *

 

Когда я, наконец, заполз в постель, на голове у меня были бигуди, на морде — грязевая маска. Я облачился в длинную мамину фланелевую пижаму. Зубы я тоже не стал чистить, надеясь, что моё «свежее» дыхание окончательно затруднит понимание между мной и папашей.

— Милая…

— Па… пожалуйста, давай спать, дорогой, — вовремя поправился я. — Увидимся утром.

Прижавшись ко мне, отец улыбнулся:

— Ах ты, шалунья. Знаешь ведь, как мне нравится слизывать с твоего личика это косметическое дерьмо и срывать зубами бигуди, — уже поглаживая мне шею, он добавил. — А эта миленькая пижамка, ты даже поверить не можешь, как она меня заводит.

Ни хуя себе! Кто же знал, что у папеньки извращённая страсть к бигудям и всякой такой херне? Я-то наделся охладить его, а он, наоборот, так разогрелся, что аж искры сыпятся. Видимо, мой папик — полный идиот. В любом случае, я вляпался в дерьмо по самые бакенбарды.

— Ммм, — лаская мои сиськи сквозь толстую ткань, он предложил. — Почему бы тебе ни пососать моего крепыша, пока я избавлю тебя от бигудей. А когда я кончу на твою прелестную мордашку, то смогу дочиста вылизать тебя.

 

 

Да не в жизнь. Несмотря на тело, сознанием-то я был мужчина. И ни за что на свете не стану сосать член другому парню. И уж тем более не собираюсь это делать родному отцу. К несчастью, моё тело, похоже, думало совсем иначе. Наплевав на внутренний протест, соски затвердели, клитор набух, а писька резко намокла. Испытывая к самому себе глубочайшее омерзение, я чувствовал, что меня эта ситуация сильно возбуждает. Так сильно я не заводился даже, когда был парнем.

Пойманный в ловушку податливого маминого тела, я не мог сопротивляться отцу, надавившему мне на плечи. Он устроился снизу, и я вовсю чувствовал запах его члена.

— Открой пошире ротик, масенькая моя, — сюсюкал папаша. — Папочка приготовил большой-большой сюрприз для своей девочки.

Внимание! У Вас нет прав для просмотра скрытого текста.

 

 

Наконец, он полностью облизал моё лицо, всё прекрасно, — если не думать, что теперь у меня вся морда в его слюнях. Мне было противно и стыдно за свой поступок, но, по крайней мере, всё позади. Поблагодарив его за великолепную ночь, я перевернулся на бок и притворился спящим.

Внимание! У Вас нет прав для просмотра скрытого текста.

Целуя сзади меня в шею, папик проворковал:

— Ты просто лежи, голуба моя, и наслаждайся. Я хочу отблагодарить тебя за лучший минет в моей жизни, и думаю, что оргазм — это как раз то, что доктор прописал.

Уткнувшись лицом в подушку, я старался не заплакать, но слёзы стыда всё равно текли по щекам. Сначала моя попытка охладить в нём страсть полностью провалилась. Потом отчаянный минет, который я ему сделал, оказался лучшим в жизни. А теперь родной отец усердно дрючит меня, и всё это закончится только тогда, когда он затопит мою матку спермой. Сгорая от стыда и отвращения, всё, что я мог сделать — это лежать и ждать окончания кошмара.

 

* * *

 

— Ой, ой! Дебра, что же ты наделала.

— Чего? — я проснулся и снова увидел себя стоявшего возле постели.

Обмена не произошло! Я всё ещё был в теле матери! Как следует оттраханном, полном до краёв спермой теле! Однако, чувствуя влагу между ног, я едва удержался от искушения сунуть в пизду палец, а потом облизать его. Её тело было очень сильно по части инстинктов, независимо оттого, чья сущность сидела внутри.

— Вставай, — сказала мать. — Пошевеливайся, и тащи свою задницу в ванную, пока всё тут кровью не загадила.

— Ой, чёрт! — захныкал я. — Он, наверно, мне что-нибудь порвал, а? У него такой здоровый! Я даже не смог остановить его.

— Дебилка, — вздохнула мать. — У тебя месячные начались.

Твою мать! Я же не справлюсь один.

— Пожалуйста, помоги мне, мам, — взмолился я. — Я ж понятия не имею, что нужно делать.

— Хорошо, — она привела меня в ванную. — В первый раз я тебе помогу, но потом всё будешь делать сам. Сначала пописай, как следует, затем мы приведём тебя в порядок, а после этого придёт черёд тампакса.

— Мам, почему мы не превратились обратно? — я не перестав хныкать. — Неужели это навсегда.

— Не знаю, — пожала она плечами. — Хоть бы и так. Это не конец света. Кстати, моими стараниями ты теперь получаешь на два доллара в час больше.

Наконец-то хорошие новости.

— Это как же? Я ведь ещё даже не состою в профсоюзе.

— Уже состоишь, — мама достала из аптечки коробку с тампонами. — Там в правлении есть три парня, оснащены как кони…

Поглаживая пластиковый аппликатор моего первого «тампакса», она чмокнула головку тампона и продолжила:

— …Я отсосала у них за ленчем, а они вручили мне профсоюзную карточку и подняли зарплату.

— Нет, — разревелся я. — Пожалуйста, скажи, что пошутила.

Теперь, даже если я вернусь к моей старой жизни, то покоя мне больше не будет. Останусь ли я в мамином теле, верну ли своё, найдутся те, кто захочет от меня получить сами знаете что.

Протянув мне тампон, она засмеялась и подтвердила мои опасения:

— Единственное условие — мне придётся обслуживать их так каждый вечер. Сперма у них, конечно, гораздо вкуснее, чем у твоего отца, если станешь опять самим собой, то будет возможность сравнить.

Грубо засунув в меня тампон, маман ущипнула меня за грудь и отошла в сторону. Расстегнув брюки, она вытащила наружу член, ранее принадлежавший мне, в моей мужской ипостаси, и осведомилась:

— Как насчёт небольшой практики? В конце концов, не так уж часто у парня появляется возможность пососать свой собственный член.

Сочетание жутких обстоятельств, стыда, чувства вины и разбушевавшихся женских гормонов было чересчур для меня. Полностью сломленный, стеная, я сполз с унитаза, с ужасом думая о том, что мне придётся провести ещё один день в теле матери, и о том, что ждёт меня, если я снова стану самим собой. Её руки обвились вокруг меня, а я отчаянно двигал головой взад-вперёд, и мне было глубоко плевать, что кто-нибудь нас увидит.

Мать с улыбкой застегнула джинсы и пошла к дверям. Проходя через спальню, она обернулась и бросила мне:

— Когда надоест себя жалеть, может, простирнёшь простыни. Знаешь, кровь очень быстро впитывается.

Рассмеявшись, маман ушла, оставив меня с кошмаром, который, похоже, уже никогда не кончится…

 

* * *

Julijana : Julijana.SU

Julijana.su

Julijana.su Daily Stats
  Daily Unique Visitors 34
  Daily Pageviews 270
  Daily Ads Revenue $0
Julijana. su Monthly Stats
  Monthly Unique Visitors 998
  Monthly Pageviews 7,973
  Monthly Ads Revenue $8
Julijana.su Yearly Stats
  Yearly Unique Visitors 12,347
  Yearly Pageviews 98,615
  Yearly Ads Revenue $99

Julijana.su or simply julijana receives roughly 270 pageviews (page impressions) daily from it’s 34 unique daily visitor. Julijana was registered and it’s hosted on the IP Address 185. 20.226.152 in Moscow, Russia. It has an estimated worth of $33 and a global Alexa rank of 4,417,325.

Updated 10 months ago

Update Now!

Julijana.su Basic information

Domain name julijana.su
Title

Julijana.SU

Keywords

julijana джулиджана,волшебные превращения мужчины в женщину,гендерная метаморфоза Male-to-Female,гендерные метаморфозы MtF,magical mtf male-to-female transformations,трансвестит и транссексуал,кроссдрессер транс преобразования,истории фантастика приключение трансов,превращение мужчины в женщину рассказы,гормональные изменения транссексуалов,смена пола при помощи магии,ищу транссексуала,transgender crossdressing,TG caption,transformation to female,male to female fantasy story,transgendered crossdresser photo,transformation change graphics,trans fiction stories,transvestite photos,transformation changes sissy,transgender stories,MtF transformations,Male-to-Female transgender,transsexuals community,pics of transvestites,TG captions

Description

Волшебные превращения мужчины в женщину

Julijana.

su Alexa Stats  

Global Rank 4,417,325
Links in 0

Julijana.su Location Stats

IP Address 185.20.226.152
Country Russia
Region Moscow
City Moscow
Longitude 37. 6173
Latitude 55.7558

Julijana.su Header

  Julijana.su DNS Records

  Julijana.su SSL Certificate

  Julijana.su WHOIS

% By submitting a query to RIPN’s Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: JULIJANA.SU
nserver: ns5.hosting.reg.ru.
nserver: ns6. hosting.reg.ru.
state: REGISTERED, DELEGATED
person: Private Person
e-mail: [email protected]
registrar: REGRU-SU
created: 2016-10-11T18:42:07Z
paid-till: 2022-10-11T18:42:07Z
free-date: 2022-11-13
source: TCI

Last updated on 2021-10-17T08:01:30Z

Recently Viewed Websites

spanglishmix.netnavjyotieyecentre.indtscientific.comzelear.comwhoi.am

Top 1 Similar websites like julijana.su and alternatives

julijana.su
волшебные превращения мужчины в женщину

Categories: Forum/Bulletin Boards, ADULT
Topics: julijana джулиджана, magical mtf male-to-female transformations, волшебные превращения мужчины в женщину, гендерная метаморфоза Male-to-Female, гендерные метаморфозы MtF, гормональные изменения транссексуалов, истории фантастика приключение трансов, кроссдрессер транс преобразования, превращение мужчины в женщину рассказы, трансвестит и транссексуал


Semrush Rank: 18,212,220 Est. Website Worth: $ 0



transgender.ru       
Community
Сайт транссексуалов, трансвеститов, гермафродитов и трансгендеров — бесплатно читать онлайн про смену пола транссексуалов, феминизацию, кроссдрессинг. Бесплатное фото и видео трансвеститов, транссексуалов и гермафродитов.

Semrush Rank: 61,119,208 Website Worth: $ 0
Categories: Sexual Materials, ADULT

Is it similar? Yes 0  No 0


Suggest Site to this list (julijana.su)

    Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it’s completely similar.

Site Url

Why do you think it is similar?

Email address We’ll never share your email with anyone else. You’ll get a confirmation email.

4 (times) 5

I’m sure it’s similar  Yes

Check out some other websites

biographyly. com  
Biographyly
Search who you love
Moz DA: 11 Moz Rank: 1.7 Semrush Rank: 332,427 Website Worth: $ 3,600

rajasahib.com  
Raja Sahib: Pakistani Designers Branded Clothing, Accessories & More
Raja Sahib Online Has The Largest Collection Of Pakistani Original Branded Designers Suits, Like Lawn, Embroidered & Printed Suits. We Do Have Wide Range Of Women’s, Men’s & Kids Clothing & Accessories. We Do Have Toys, Games, Stationary, Kitchen and Electronic Appliances, Home and Lifestyle Accessories & Other Stuffs.
Moz DA: 11 Moz Rank: 2.3 Semrush Rank: 857,971 Website Worth: $ 8,700

zanerpharma.com  
Domain Currently Under Maintenance
Domain Currently Under Maintenance
Moz DA: 11 Moz Rank: 1.9 Semrush Rank: 615,880 Website Worth: $ 200

isharoisharomeinserial.com  
Loading…
Loading…
Moz DA: 11 Moz Rank: 2. 9 Semrush Rank: 164,973 Website Worth: $ 1,000

amz123.com  
AMZ123亚马逊导航-跨境电商出海门户
AMZ123亚马逊导航是一家致力于服务中国跨境电商从业者的综合平台,以让跨境电商出海更便捷为使命,始终围绕卖家需求,为卖家提供实时的跨境资讯,实用的跨境干货、工具、数据和服务,打造一站式跨境流量入口。做跨境电商,就上AMZ123。
Moz DA: 11 Moz Rank: 4.2 Semrush Rank: 488,586 Website Worth: $ 20,100

grabstudy.com  
grabSTUDY — A Best Platform for Competitive Exams | Free Online Test Series
Grabstudy is A Best Way To Prepare For Competitive Exams, Crack Gate Exam, Crack Government Job Exams, Free Mock Test Series, Engineering Career Related & Job Oriented Objective Questions.
Moz DA: 11 Moz Rank: 2.8 Semrush Rank: 938,011 Website Worth: $ 600

timesinternational.net  
Times International — Creating New Ideas and Stories for the World
Creating New Ideas and Stories to the World in the Digital Age / Free Books + tutorials for career builders / Resources and much more.
Moz DA: 11 Moz Rank: 1.9 Semrush Rank: 314,099 Website Worth: $ 1,800

sdmoviespoint.me  
SD Movies Point — Free HD Movies Download
SD Movies Point Download Latest HD Movies Free For All types of Devices, Mobiles, PC, Tablets. sdmoviespoint Download Free 720p HD Bollywood, Hollywood And All kind Of Movies For Free. SDMoviesPoint.
Moz DA: 12 Moz Rank: 1.3 Semrush Rank: 148,999 Website Worth: $ 200

movieland.to  
Loading…
Loading…
Moz DA: 12 Moz Rank: 1.5 Semrush Rank: 248,070 Website Worth: $ 400

janibcn.com  
JaniBcn.Com — Non Stop Desi Entertenment
JaniBcn.Com — Non Stop Desi Entertenment
Moz DA: 12 Moz Rank: 3.9 Semrush Rank: 978,253 Website Worth: $ 3,000

torkjameh.com  
ترک جامه|خرید اینترنتی لباس — فروشگاه اینترنتی لباس ترک جامه
فروشگاه اینترنتی لباس پوشاک ترک اصل برند جدید خرید پستی ارزان
Moz DA: 11 Moz Rank: 3. 6 Semrush Rank: 316,820 Website Worth: $ 15,100

gharjaggabazar.com  
Real Estate Nepal, Ghar Jagga, House on Sale in Kathmandu, Housing Nepal, Land on Sale Lalitpur, Furnished Apartment for Sale Kathmandu | GharJaggaBazar.com
Real Estate Nepal, Ghar Jagga, House on Sale in Kathmandu, Housing Nepal, Land on Sale Lalitpur, Furnished Apartment for Sale Kathmandu | GharJaggaBazar.com
Moz DA: 11 Moz Rank: 2.7 Semrush Rank: 920,689 Website Worth: $ 2,300

learnpowers.com  
Learn Powers | Unleash your Powers
Unleash your Powers
Moz DA: 13 Moz Rank: 1.9 Semrush Rank: 843,420 Website Worth: $ 600

virajafashionista.com  
Uppada Sarees| kuppadam Sarees|Pochampally Sarees|Venkatagiri sarees
Buy Latest collections of Uppada Sarees,kuppadam sarees and Pochampally sarees online at Viraja Fashionista. Debit card/credit card/E-wallet accepted
Moz DA: 11 Moz Rank: 2. 2 Semrush Rank: 929,600 Website Worth: $ 500

edujournal.in  
Edu Journal
A Global Educational Portal
Moz DA: 13 Moz Rank: 3.3 Semrush Rank: 329,755 Website Worth: $ 500

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
«Similar sites like» first finds the best and top keywords for all websites and rank them.

0

Some random sites

Email: We’ll never share your email with anyone else.

Password: Minimum 6 characters.

Please fill the form and submit the request to change your website details.
You’ll receive an email to approve the change. You must use an email from the same domain not gmail, yahoo or another provider. No links allowed.

Email:

Accessible Url: http://julijana.suhttp://www.julijana.suhttps://julijana.suhttps://www.julijana.su

Title: Julijana.SU

Description: Волшебные превращения мужчины в женщину

Top Keywords(use comma(,) pls): julijana джулиджана, magical mtf male-to-female transformations, волшебные превращения мужчины в женщину, гендерная метаморфоза Male-to-Female, гендерные метаморфозы MtF, гормональные изменения транссексуалов, истории фантастика приключение трансов, кроссдрессер транс преобразования, превращение мужчины в женщину рассказы, трансвестит и транссексуал

Please write your review/experiences with this website.
We’ll be reviewing your review and approve/reject. No links are allowed. Only genuine reviews will be accepted. Please kindly note that the purpose for this section is to give as much as useful information for other people. If you’re the site owner please click icon or click here to learn how to update your website details.

Name:

Email:

This is my website

Review:

джулиджана волшебные рассказы

джулиджана волшебные рассказы

Хороший пост мне понравился ,очень даже интересно и картинки и рассказ!! Томская область > Северск [ссылка]. 0 / 0.

Кризис творчества — рассказ. Взрослые дети доктора Саманты Пинкбоу — рассказ по Новая жизнь управляющего — рассказ по рисунку Pris Талант мистера Брэдшоу — рассказ (к рисунку Prissy Вамп (The Vamp by Giles English, илл. Sardax) — пе

Очень просим особо восприимчивых особ не смотреть данное видео, но это, на самом деле, нечто невероятное — кто-то же все это придумал, продумал и опробовал – Самые лучшие и интересные посты по теме: Жизнь, интересное, операция на развлекательном портале Fishki. net

Портал » Список форумов » Творчество, Искусство » Рассказы о ТГ» Рассказ Julijana. Страница 1 из 1. [ Сообщений: 2 ].  Взято с форума Джулиджана по ссылочке с форума Джульетты Выложила Аня Грин. Julijana.

Американская студентка-трансгендер поделилась снимками из своего фотодневника, которые запечатлели ее превращение из парня в девушку за 17 месяцев заместительной гормональной терапии. Источник: Bored Panda Пользователь Imgur под ником Selgal из

Волшебные истории. Наталья Сафронова живёт и трудится в Тольятти, пишет стихи, сказки, рассказы и пьесы. Сотрудничает с литературным журналом «Город. Автор книги стихов «Бабья сказка» и книг прозы «Близнецы» и «Девичник». Член Союза Российских писателей. Нашей редакции Наталья предложила три волшебные истории о девочке Вике. Надеемся, что знакомство с Викой будет интересно юным читателям.

джулиджана волшебные рассказы ромочка by Main, released 08 July 2019  Джулиджана волшебные рассказы ромочка. Здесь собраны мои первые рассказы и переводы. Изначально они были размещены на форуме julijana. Волшебные превращения мужчины в женщину главная страница форум — волшебные превращения мужчины в женщину — инфор.

Ее завели наверх, она легла на кресло, ее привязали ремнями и закрепили ноги… Потом вышли Стив и доктор. За ними вынесли небольшой накрытый столик и поставили рядом с креслом Лу. Стив повернулся к нам и заговорил: — Вы все знаете, за что и как моя рабыня Лу была наказана. Сегодня я заберу ее домой.…

Форум julijana.ru — Волшебные превращения мужчины в женщину. Тема гендерных метаморфоз в литературе и изобразительном искусстве (Magical MtF Transformations, Male-to-Female). Рассказы, комиксы, фото, картинки, общение, знакомства, чат.  Форум julijana.ru — Волшебные превращения мужчины в женщину. Тема гендерных метаморфоз в литературе и изобразительном искусстве (Magical MtF Transformations, Male-to-Female). Рассказы, комиксы, фото, картинки, общение, знакомства, чат.

Что это? Каталог блогов + каталог RSS + рейтинг блогов + комментарии — все это Блог Бустер. Blog Booster увеличивает силу вашего блога, его видимость в интернет и добавляет вам новых читателей, в том числе с помощью функции Booster (в правом сайдбаре).

Короткий рассказ о двух беспризорниках попавших в Одессу.Думаю есть юмор, TG — тема — смена пола. Иллюстрации/приложения: 1 шт. Моргана 11k Фантастика Комментарии: 2 (30/07/2018). Рассказ о легенде Фее Моргане, Морриган..как всё могло быть экскурс в давние времена. Подарок от бабы Гали 40k Фэнтези. Есть не нормативная лексика, грубые выражения.

Джулиана волшебные превращения. Временное превращение в девочку. Id: 13273 74. 15 мая 2014 | Уникальная запись. Много постов видела я здесь об операциях, сделанных японскими девушками,чтобы выглядеть «по-европейски», о Валерии Лукъяновой. Но я не нашла информации о Ульяне Романовой, достаточно известной личности, перенесшей более 15 операций Знала я хорошего парня, слегка со»сладкой» внешностью — Игоря Булгачёва.

Популярные сообщения из этого блога

undertale на psp cкачать

undertale на psp cкачать 3DS Arcade Custom / Edited DS / DSi Game Boy / GBC Game Boy Advance GameCube Genesis / 32X / SCD Master System Mobile Neo Geo / NGCD NES Nintendo 64 Nintendo Switch PC / Computer PlayStation PlayStation 2 PlayStation 3 PlayStation 4 PlayStation Vita PSP SNES Wii Wii U Xbox 360 Other Systems. Non-Undertale Mods are allowed IF they are still Undertale related. No need for spoiler text in this sub, people who have beaten the game will come here. Posts will have to have a flair attached, no matter what as of 8/25/19.  So since undertale was made off of game maker pro or something and after doing research I discovered there’s a way to port game maker games to psp. I know it’s possible to change what system it works for since I’ve already got it on Android but having the trash on screen controls just don’t cut it. So can anyone help accomplish this port or link me to the iso? TL;DR: use gamemaker to port undertale to psp? 3 comments. share. Скачайте и

Далее…

подология норберт шольц

подология норберт шольц Норберт Шольц. Крефельд, Германия. Врач, основатель ряда медицинских сообществ, владелец медицинской практики. С 1988 специализируется на заболеваниях стопы. Автор книг и публикаций. Автор известного «Учебника и иллюстрированного атласа по подологии». Автор современной монографии «Экстремальные случаи из подологической практики». Книги по различным проблемам подологии: онихомикозам, грибкам ногтей, вросшим и вростающим ногтям, гиперкератозам, трещинам.  Выделены подходы к комбинированной и корригирующей терапии. Впервые сформулирована концепция первичной и вторичной профилактики онихомикозов, включая общественную профилактику и организацию кампаний по активному выявлению заболевания. Норберт Шольц. Виктор Александрович Мицкевич. На стыке медицины и косметологии появилась «подология» (подиатрия) — это медицинская наука, занимающаяся изучением и лечением заболеваний стопы и голени.  Подологию как науку в России начали изучать с 2006 года, тогда

Далее…

volkswagen tiguan 2020 инструкция по эксплуатации

volkswagen tiguan 2020 инструкция по эксплуатации Форум Volkswagen Tiguan 2 (2019-2020), обсуждение: эксплуатация, поломки и неисправности, их ремонт — 1-я страница.  Обсуждение особенностей эксплуатации и обслуживания автомобиля Volkswagen Tiguan 2 (2019-2020), описание часто встречающихся неисправностей и методов их решения (устранение поломок / ремонт). Максим | 26 февраля 2017. Автомобиль в использовании чуть меньше недели. Дополнение к отзыву владельца о Фольксваген Тигуан 2012: Особенности эксплуатации Тигуана, Добрый день, уважаемые дромовцы, Тула, механическая коробка передач, расход Город 9-11.5 л/100 км, трасса 6-8.5 л/100 км, 1.4 л., Тульская область.  Особенности эксплуатации Тигуана. Volkswagen Tiguan 2012. DJ_MAXX, Тула Пробег: 18 770 км Темы: Эксплуатация | Ремонт и обслуживание | Другое. Добрый день, уважаемые дромовцы. Давненько я свой отзыв не дополнял. Попробую сейчас восполнить этот пробел и вспомнить все сколько-нибудь интересное, связанное с эксплуатацией Тиги. В

Далее…

Обзор веб-сайта | julijana.su

julijana.su website Скриншот

julijana.su

Julijana.SU

25 Апреля 2021 {Hour}:{Minute} julijana.su ОБНОВИТЬ

Волшебные превращения мужчины в женщину. julijana джулиджана,волшебные превращения мужчины в женщину,гендерная метаморфоза Male-to-Female,гендерные метаморфозы MtF,magical mtf male-to-female transformations,трансвестит и транссексуал,кроссдр.

SEO Оценка
Скорость Оценка
Дизайн Оценка

Julijana.su Отчет по эффективности SEO

11 письма

Заголовок страницы

Замечательно, Ваш заголовок страницы содержит от 10 до 70 символов.

39 письма

Описание страницы

Замечательно, Ваше описание страницы содержит от 70 до 160 символов.

25 кусок

Картинки

Мы нашли 25 картинок на этом веб-сайте. 23 alt атрибута(-ов) не найдено. Добавив альтернативный текст, поисковые роботы будут лучше понимать содержание картинки.

Соотношение Контент/HTML

Соотношение текста в коде HTML у этой страницы меньше чем 15 процентов, это означает, что Вашем веб-сайту требуется больше контента.

Flash

Замечательно, мы не нашли Flash контента на странице.

Iframe

Очень плохо, на Вашей странице были найдены Iframe’ы. Это говорит о том, что содержимое их не будет проиндексировано.

Only 10% of people worldwide have an IQ of 120 or higher. What is your IQ score? Take the real iq test to find out!

Julijana.

SU СЕО Контент

1 кусок

h2

1 кусок

h3

15 кусок

h4

11 кусок

h5

0 кусок

H5

0 кусок

H6

Заголовки

  • Julijana.SU h2
  • Julijana.SU — волшебные превращения мужчины в женщину h3
  • Добавление рассказов h4
  • У врача h4
  • Зелье древних волшебников h4
  • Встреча h4
  • Мой первый раз h4
  • Переход h4
  • Женское счастье h4
  • Письмо h4
  • Дом, где сбылась моя мечта h4
  • Чужое наказание h4
  • Иллюзия любви h4
  • Будь смелой, береги себя h4
  • Как я стал «женщиной» h4
  • Игры в Иглы h4
  • Творец судьбы h4
  • Навигация по сайту h5
  • Популярные статьи h5
  • Реклама h5
  • Календарь h5
  •   h5
  • Реклама h5
  • Новости партнеров h5
  • Реклама h5
  • Навигация h5
  • Облако тегов h5
  • Архив новостей h5

Og Meta Properties

Вы не используете преимущества Og Properties. Эти мета-тэги помогают социальным роботам лучше структурировать Ваш сайт. Используйте бесплатный генератор og properties, чтобы создать их.

julijana.su СЕО ссылки

Мы нашли 124 ссылок(-и), включая 0 ссылок ссылок(-и) на файл(-ы).

ЧПУ ссылки: Отлично, все Ваши ссылки являются ЧПУ!

Нижнее подчеркивание в ссылках: Прекрасно! Мы не нашли «нижнее подчеркивание» в Ваших ссылках.

Внутренние ссылки

  • Внутренние ссылки 96.77%

  • Внешние ссылки [Передает вес 3.23%]

  • Внешние ссылки [noFollow 0%]

julijana.su — Таблица внутренних ссылок

Анкор Link Тип Вес ссылки
Julijana.SU http://julijana.su/index.php Внутренняя Передает вес
Забыли? https://julijana.su/index.php?do=lostpassword Внутренняя Передает вес
Мы в Twitter http://julijana. su/# Внутренняя Передает вес
Мы в vKontakte https://vk.com/julijanasu Внешняя Передает вес
О сайте http://julijana.su/about.html Внутренняя Передает вес
Литература http://julijana.su/liter Внутренняя Передает вес
Вопросы и ответы http://julijana.su/faq Внутренняя Передает вес
Картинки http://julijana.su/foto-n-pic Внутренняя Передает вес
Болталка http://julijana.su/faq/blabla Внутренняя Передает вес
Новости http://julijana.su/admin/news Внутренняя Передает вес
Не в Т*+ему http://julijana.su/no-t Внутренняя Передает вес
2 https://julijana.su/page/2/ Внутренняя Передает вес
3 https://julijana. su/page/3/ Внутренняя Передает вес
4 https://julijana.su/page/4/ Внутренняя Передает вес
5 https://julijana.su/page/5/ Внутренняя Передает вес
6 https://julijana.su/page/6/ Внутренняя Передает вес
7 https://julijana.su/page/7/ Внутренняя Передает вес
8 https://julijana.su/page/8/ Внутренняя Передает вес
9 https://julijana.su/page/9/ Внутренняя Передает вес
10 https://julijana.su/page/10/ Внутренняя Передает вес
39 https://julijana.su/page/39/ Внутренняя Передает вес
AdminVladelec https://julijana.su/user/AdminVladelec/ Внутренняя Передает вес
Добавление рассказов https://julijana. su/admin/news/584-dobavlenie-rasskazov.html Внутренняя Передает вес
Администраторская https://julijana.su/admin/ Внутренняя Передает вес
Новости https://julijana.su/admin/news/ Внутренняя Передает вес
1 https://julijana.su/admin/news/584-dobavlenie-rasskazov.html#comment Внутренняя Передает вес
У врача https://julijana.su/liter/trans/615-u-vracha.html Внутренняя Передает вес
Литература https://julijana.su/liter/ Внутренняя Передает вес
Транс https://julijana.su/liter/trans/ Внутренняя Передает вес
https://julijana.su/liter/trans/615-u-vracha.html#comment Внутренняя Передает вес
Зелье древних волшебников https://julijana.su/liter/magic/600-zele-drevnih-volshebnikov. html Внутренняя Передает вес
Волшебные превращения https://julijana.su/liter/magic/ Внутренняя Передает вес
https://julijana.su/liter/magic/600-zele-drevnih-volshebnikov.html#commen Внутренняя Передает вес
Встреча https://julijana.su/liter/trans/599-vstrecha.html Внутренняя Передает вес
https://julijana.su/liter/trans/599-vstrecha.html#comment Внутренняя Передает вес
Мой первый раз https://julijana.su/liter/trans/614-moj-pervyj-raz.html Внутренняя Передает вес
https://julijana.su/liter/trans/614-moj-pervyj-raz.html#comment Внутренняя Передает вес
Переход https://julijana.su/liter/magic/598-perehod.html Внутренняя Передает вес
https://julijana. su/liter/magic/598-perehod.html#comment Внутренняя Передает вес
Женское счастье https://julijana.su/liter/gays-n-bi/613-zhenskoe-schaste.html Внутренняя Передает вес
Геи и бисексуалы https://julijana.su/liter/gays-n-bi/ Внутренняя Передает вес
https://julijana.su/liter/gays-n-bi/613-zhenskoe-schaste.html#comment Внутренняя Передает вес
Письмо https://julijana.su/liter/trans/597-pismo.html Внутренняя Передает вес
https://julijana.su/liter/trans/597-pismo.html#comment Внутренняя Передает вес
Дом, где сбылась моя мечта https://julijana.su/liter/gays-n-bi/612-dom-gde-sbylas-moja-mechta.html Внутренняя Передает вес
https://julijana.su/liter/gays-n-bi/612-dom-gde-sbylas-moja-mechta. html#c Внутренняя Передает вес
Чужое наказание https://julijana.su/liter/femin/611-chuzhoe-nakazanie.html Внутренняя Передает вес
Принудительная феминизация https://julijana.su/liter/femin/ Внутренняя Передает вес
https://julijana.su/liter/femin/611-chuzhoe-nakazanie.html#comment Внутренняя Передает вес
Иллюзия любви https://julijana.su/liter/trans/596-illjuzija-ljubvi.html Внутренняя Передает вес
https://julijana.su/liter/trans/596-illjuzija-ljubvi.html#comment Внутренняя Передает вес
Будь смелой, береги себя https://julijana.su/liter/misc/610-bud-smeloj-beregi-sebja.html Внутренняя Передает вес
Другое https://julijana.su/liter/misc/ Внутренняя Передает вес
https://julijana. su/liter/misc/610-bud-smeloj-beregi-sebja.html#comment Внутренняя Передает вес
Как я стал «женщиной» https://julijana.su/liter/gays-n-bi/609-kak-ja-stal-zhenschinoj.html Внутренняя Передает вес
https://julijana.su/liter/gays-n-bi/609-kak-ja-stal-zhenschinoj.html#comm Внутренняя Передает вес
Игры в Иглы https://julijana.su/liter/gays-n-bi/595-igry-v-igly.html Внутренняя Передает вес
https://julijana.su/liter/gays-n-bi/595-igry-v-igly.html#comment Внутренняя Передает вес
Творец судьбы https://julijana.su/liter/magic/608-tvorec-sudby.html Внутренняя Передает вес
https://julijana.su/liter/magic/608-tvorec-sudby.html#comment Внутренняя Передает вес
Волшебные превращения http://julijana. su/liter/magic Внутренняя Передает вес
Игры http://julijana.su/liter/games Внутренняя Передает вес
Истории http://julijana.su/liter/history Внутренняя Передает вес
Транс* http://julijana.su/liter/trans Внутренняя Передает вес
Феминизация http://julijana.su/liter/femin Внутренняя Передает вес
Личность http://julijana.su/liter/psi Внутренняя Передает вес
Геи и би http://julijana.su/liter/gays-n-bi Внутренняя Передает вес
Фетишизм http://julijana.su/liter/fetish Внутренняя Передает вес
Стихи http://julijana.su/liter/poet Внутренняя Передает вес
Переводы http://julijana.su/liter/perevod Внутренняя Передает вес
In English http://julijana. su/liter/english Внутренняя Передает вес
Другое http://julijana.su/liter/misc Внутренняя Передает вес
Опросы http://julijana.su/faq/vote Внутренняя Передает вес
Поздравления http://julijana.su/faq/compliment Внутренняя Передает вес
Про эротику и секс http://julijana.su/faq/eros Внутренняя Передает вес
Гормоны http://julijana.su/faq/hormon Внутренняя Передает вес
Увеличение груди, протезы http://julijana.su/faq/bubs Внутренняя Передает вес
Бритьё и эпиляция http://julijana.su/faq/epil Внутренняя Передает вес
Голос и речь http://julijana.su/faq/voise Внутренняя Передает вес
Одежда, обувь, стиль http://julijana. su/faq/style Внутренняя Передает вес
Парики и пречёски http://julijana.su/faq/haer Внутренняя Передает вес
Макияж, маникюр, педикюр http://julijana.su/faq/makeup Внутренняя Передает вес
Диета и гимнастика http://julijana.su/faq/diet Внутренняя Передает вес
Фотографирование http://julijana.su/faq/fotograf Внутренняя Передает вес
Барахолка http://julijana.su/faq/ptp Внутренняя Передает вес
Ваши фотографии http://julijana.su/foto-n-pic/ifoto Внутренняя Передает вес
Не (совсем) ваши фотографии http://julijana.su/foto-n-pic/nifoto Внутренняя Передает вес
Фотомонтажи http://julijana.su/foto-n-pic/photoshop Внутренняя Передает вес
Фотобайки и рассказы по фото http://julijana. su/foto-n-pic/caps Внутренняя Передает вес
Рисунки, анимашки и комиксы http://julijana.su/foto-n-pic/pic Внутренняя Передает вес
ХХХ (18+) http://julijana.su/foto-n-pic/xnxx Внутренняя Передает вес
Знакомства http://julijana.su/dating Внутренняя Передает вес
Выяснение отношений http://julijana.su/no-t/bla-gav Внутренняя Передает вес
Вопросы и предложения http://julijana.su/no-t/fb Внутренняя Передает вес
Ссылки http://julijana.su/no-t/links Внутренняя Передает вес
Группы на сайте http://julijana.su/group.html Внутренняя Передает вес
Пополнение баланса http://julijana.su/index.php?do=webcash&action=plugin&alias=upbalance Внутренняя Передает вес
Переход в группу http://julijana. su/index.php?do=webcash&action=plugin&alias=changegroup Внутренняя Передает вес
Реклама на сайте http://julijana.su/reklama.html Внутренняя Передает вес
Поддержка сайта http://vedun.info/ Внешняя Передает вес
Расширенный поиск http://julijana.su/index.php?do=search&mode=advanced Внутренняя Передает вес
Все последние новости http://julijana.su/index.php?do=lastnews Внутренняя Передает вес
Мобильная версия сайта http://julijana.su/index.php?action=mobile Внутренняя Передает вес
Another side of soul https://julijana.su/liter/magic/592-another-side-of-soul.html Внутренняя Передает вес
Света и её свадьба https://julijana.su/liter/magic/593-sveta-i-ee-svadba.html Внутренняя Передает вес
Невыдуманная история https://julijana. su/liter/magic/594-nevydumannaja-istorija.html Внутренняя Передает вес
Лицемерие https://julijana.su/liter/history/591-licemerie.html Внутренняя Передает вес
« https://julijana.su/2021/03/ Внутренняя Передает вес
15 https://julijana.su/2021/04/15/ Внутренняя Передает вес
16 https://julijana.su/2021/04/16/ Внутренняя Передает вес
17 https://julijana.su/2021/04/17/ Внутренняя Передает вес
18 https://julijana.su/2021/04/18/ Внутренняя Передает вес
19 https://julijana.su/2021/04/19/ Внутренняя Передает вес
20 https://julijana.su/2021/04/20/ Внутренняя Передает вес
21 https://julijana.su/2021/04/21/ Внутренняя Передает вес
22 https://julijana. su/2021/04/22/ Внутренняя Передает вес
23 https://julijana.su/2021/04/23/ Внутренняя Передает вес
24 https://julijana.su/2021/04/24/ Внутренняя Передает вес
Регистрация http://julijana.su/index.php?do=register Внутренняя Передает вес
Новое на сайте http://julijana.su/newposts Внутренняя Передает вес
Статистика http://julijana.su/statistics.html Внутренняя Передает вес
Поддержка сайта http://vedun.info Внешняя Передает вес
ANIS http://nikolev.com Внешняя Передает вес
Julijana.SU http://julijana.su Внутренняя Передает вес

julijana.su Ключевые слова

Содержание ключевых слов for Julijana.

su
Ключевое слово Контент Заголовок страницы Ключевые слова Описание страницы Заголовки
новости 11
литература 8
автор 7
информация 7
категория 7
комментариев 7
подробнее 7
дата 7
adminvladelec 7
просмотров 7
что 5
сайте 5

Облако ключевых слов for julijana.

su

комментариев X7 вчера X4 сайте X5 быть X2 игры X2 павел X3 информация X7 июль X3 превращения X4 под X3 пыльной X2 назад X2 навигация X2 дата X7 что X5 julijanasu X3 рассказов X2 раз X3 сайта X3 неужели X3 литература X8 мне X4 был X2 никогда X2 adminvladelec X7 подробнее X7 декабрь X4 апрель X3 него X3 категория X7 время X3 автор X7 февраль X4 транс X4 волшебные X4 было X4 геи X2 так X3 новости X11 мужчина X2 ноябрь X3 администраторская X2 фотографии X3 его X4 реклама X4 январь X3 вопросы X3 переход X3 просмотров X7 здесь X2

julijana.su Юзабилити

Домен

11 Длина

Кодировка

Замечательно. Кодировка веб-сайта: UTF-8.

Язык

Хорошо, Ваш установленный язык веб-сайта: RU.

Устаревший HTML

Устаревшие HTML теги — это теги, которые никогда больше не будут используются. Рекомендуется удалить, либо заменить их на CSS правила.

Favicon

Отлично, Ваш сайт имеет favicon.

Приватность эл.
почты

Внимание! Как минимум 1 адрес эл. почты был найден в контенте. Воспользуйтесь бесплатной защитой от спама, чтобы скрыть адрес от спамеров.

Dublin Core

Ваш веб-сайт не использует преимущества Dublin Core.

Пригодность для печати

Плохо. Мы не нашли CSS файл, отвечающий за печать веб-сайта.

julijana.su Оптимизация

XHTML 1.0 Transitional
Design

44
файлы

25
image

Стандарт W3C

  • W3C Validity
  • Ошибок 33
  • Предупреждений 45
  • julijana.su W3C Validity
  • W3C отчеты о качестве
  • Отлично, Ваш веб-сайт не содержит вложенных таблиц.
  • Слишком плохо. Ваш веб-сайт использует встроенные CSS правила в HTML тэгах.
  • Плохо. Ваш веб-сайт имеет слишком много CSS файлов (больше чем 4).
  • Плохо. Ваш веб-сайт имеет слишком много JavaScript файлов (больше чем {MoreNr}).

Документ

  • Оптимизация под моб. телефон
  • Apple иконки
  • Meta Viewport Тэг
  • Robots.txt
  • Отлично, ваш веб-сайт содержит файл robots.txt.
  • http://julijana.su/robots.txt
  • Аналитика
  • Отлично, на вашем сайте присутствуют аналитические программы.
  • LiveInternet

Julijana.su Website статика

  • julijana.su IP No 185.20.226.152
  • Страна Популярных Russia
  • Time Zone Europe/Moscow
  • ISP Reg.Ru

Статика обратных ссылок

julijana.su Similar Sites & Alternatives

Сервис коротких ссылок

lcut.us

Есть идея? Банк идей. Готовый бизнес.

idea-4-u.ru

julijana.su Site Summary

julijana.su, julijana.su — волшебные превращения мужчины в женщину, навигация по сайту, популярные статьи, реклама, календарь,  , реклама, новости партнеров, реклама, навигация, облако тегов, архив новостей, добавление рассказов, у врача, зелье древних волшебников, встреча, мой первый раз, переход, женское счастье, письмо, дом, где сбылась моя мечта, чужое наказание, иллюзия любви, будь смелой, береги себя, как я стал «женщиной», игры в иглы, творец судьбы, комментариев, вчера, сайте, быть, игры, павел, информация, июль, превращения, под, пыльной, назад, навигация, дата, что, julijanasu, рассказов, раз, сайта, неужели, литература, мне, был, никогда, adminvladelec, подробнее, декабрь, апрель, него, категория, время, автор, февраль, транс, волшебные, было, геи, так, новости, мужчина, ноябрь, администраторская, фотографии, его, реклама, январь, вопросы, переход, просмотров, здесь, julijana. su.

Устаревший HTML!
Устаревшие тэги Найдено
<center> 1

Бесплатный SEO отчет

Товары – Tagged «julijana» – Галерея 104


Все товары All»gare aux loups!»»no. 100080″»The upper one is better off”#2#3#4-pm000001002003004040611010010001000 full color printing104111212 x 121250131371414715181811st1stdibs1stdibs design center220182018-022018-032018-06201

0255262727528330300373D44144550’s50050s660s7701727507th880869

9\art on canvasaA.h. aaltoabandonedabdabdulabhaAbha Rani Singhaboutaboveabsenceabstracabstractabstract artabstract artistabstract expressionismabstract figureabstract portraitabstrctabyssabyssesAcquiescence IIacrylicacrylic on canvasacrylic paintingactacylicacyrlicadadamaddictionaddisonadeadhoadrienneadriftadventureadversityaereasafireafricaafricanafterafternoonafterthoughtagataage of aquariusageishaagentagnesaguileraAHaheadaiazziairairplaneakaakenborakimovaakualalaskaalcohol inkaldinaleksandraalexalexaalexanderalexandraalexisAlexis koskinisalfiealfredoalgalalgal bloomalicealienalinaAlina nistoraliningaliumeallalleallenalmostalonealongalteridadAlu Dibondaluminumaluminum dibondaluminum. paisaalvaradoalvar exalvarezalwaysalysiaamamabelamaiaamaleamaleboutammineamatoamedeaamethystamidstammoammonamongamoramoreamyanaanabellaanandAnarchiaanatomyanbinderandandersonandreaandreasandreasenandreeaandresandrewandrieuandrogynieangelsangleangryanimalaninankeAnke Schüttfort-Hohmannankeshuttfortannannaanneanneliseanniversaryannunciationanotheranthemanthonyanticantonioantoniouanvaanwaranyanzabiapacheapeappapplesapplicationapplication fee $35aquaararancioarblomarchitectarchivalarcosarcticarearistaritstarkestraarmsarrarresterarribaarrogancearronartart walkartartistartiartistartist addartist representationartistblueartistsartmiartorkartowrkartphiartristartsyarturoarturo medinaarturo reyes medinaartworartworkaryclicasas seenaseashoreaspettandoassayatataraxiaatmosphereattitudeattractattractionatwzAtyrauaudacieseaudreyaugustinauraaustinautumautumnAutunalavaaveavecavendanoavenueavreawakeningawardawayawhileazarovaazizazur’sbbabydollsbabylonianbachabadbagbagsbahabaibabairbakerbakkerbaladebalanbalancebalarinaball barbarabarbarianbardotbarquerobarsoumianBaruchbas reliefbastienBastien Ducourtiouxbaterflybathroombatsbaybazookabebeacchbeachbeanbeautifulbeautybecausebechbecomesbeddingbeddrubeebybeforebegegnungbeginningbehind the scenesbeigebeingbelievebellezzabelyaevabeneathbennybentbergachtigberkersbernardberrybertholetbertranbessbesstsonisbetabethbettybetweenbexbeyondbezicbhbianchibiangongabibbybienertbindbirchbirchwoodbirdbirdsbirgitbirnbaumbirthdaybjelicablackblack and whiteblackbirdsblackbirdsnbladhblancsblankbleedingbleublissblocksbloodBloodybloombloomingblossomblotchesblueblue skybluepinkbluesblvdbmboboaenboardbobbobbiBoccadasseboddbodyboeboenbohemianboldbombartbombshellsbondagebonesboomboonebootboothborisbouchardbougainvillaboundbountybouquetboutamminebowebowenboxboxesboyboysbrabrainwavebrandbrandobrandonbrassbreakbreak freebreakthroughbreastsbreathbreathebreezebrendabrenerBrettBrianbriannabridgebridgesbrightbrigittebrittbrknbroadwaybrokenbrokenthomasbrokenthomasthomasbronzebrookbrookebrookl ynbrowbrowbbrownbrowserbrucebrueBruggerbrunobrushbruunbuckbuffetbuildingbuildingsbullenbulowbureaucracyburgundyburkeburlowburningBurstburtbutbutenhofbuttbutterflybyccacabanoncabinetCaelCael Pipincaercagecailincaimancalascaliforniacallacallositycalmcamblincamelcamillecamillericammycamoflagecampocampoycamuflajecancanarycanascandelightcandycannotcantcanterounacanvascanvas originalcanvastherapycaocaoscaptivecapturecarcaracarbonidecardcardboardcarecarloscarlssoncarlssonpixel blue no. 1carolcarolinecarpcarpscarrcarylcasacascadingcaseycassirercastcatcataclysmcatchcaterinacatharsiscatherinecathycaveccceciliacecilieceliacentral parkcenturyceramiccernycescattiCGchaechainbreakerchairchampenychangechaoschaplinCharalamposCharalampos Panagiotopouloscharcoalcharcoal on papercharissacharlescharletcharliecharlottecharoussetcharutachasmcheetacheetahcherrychessboardchestchevillottechicchicagochikhichildchildrenchoicechoiceschrilzchrischristachristinachristophchristopherchristyciciocidadecirclecirclescirujiacitruscitycity on firecityscapecityuclaireclaraclarityclassicclaudiaclaudiahoffmannclaycleacleanerclearingcleopatraclimbclimbingcloudcloudscoastcobaltococooncoelhocoincidencecoldcolettecolilisioncollagecollardcollectablecollectioncollectorcolorcolor pencilcolorescolorfulcolorscolourfulcolumncolumnscomecomescomfortcomfortablecommercialcommunitycomplicatedcompositecomputer deskconconceptconceptualconceptualmmiseryconchita riveracondicioncondonconfusedconnallyconnectedconnectionc onquerconsciousnessconsistencyconstellationconsumercontemporarartcontemporararycontemporaraycontemporarycontemporary artcontinuescontrolconvasconvergenceconvolutioncoolcoonellycopingcoppercorbusierscoreCoriolisCorioliseffectcornercorralcortecorwcosmoscottoncouchcouldcouleurcountrycouplecoursecoveredcowcracranecranescraoncrashcrashingcravingcrawleycreamcreationcreekcrescentcreswellcretecrinklecristianecristinacrosscrossingcrowcrowdcrowncrycrystalcrystal dombroskycrystallizingcrystalscubismculturecurationcuratorcurators feecurrentcurvecurvescustomcutsCynthia UdenCôte d’Azurdd’erricodahldaisiesdalidalladamatodandancedancerdancingdanidanieldanieladanieledanielledannydanzedardarkdarknessdarlingdasdasiesdaugheertydaughertydaughtersdaviddavidsdaviesdavisdawndaydaybreadaybreakdaylightdaysdazeddazzlingdc artistdddedeanadeathdebbiedebussydeceasedecisiondecodecordecorationdecoratordedansdeepdeepcutsdefineddegendeddeldelerivedeliberationDelicatedelvedemeshiademidendenholmdenisedensitiesderderacode rekdesdescentdesiertadesigndesignerdesiredesjardinsdeskdesk chairdespairdestinydetaildetaileddetailsdeterminationdeviumdevoiddidi masternakdianadibonddibsdiddidntdierkdieuxdifficultdigitaldigital artdigital art on canvasDigital Art on Watercolor Paperdilemmadimensiondimensionsdinasourdineshdiningdinnerdinwoodiedippingdiptychdirectionsdirkdisappearencedisappearingdiscodiscoveriesdisorderdistorteddivadivedivefredrikdivingdivinitiesdodobsondododogdohrendombroskydominikadondon’t grow updonnadoordoshidoubledowdeswelldowelldowlingdowndowningdownsdownstreamdowntowndrawersdrawingdrawsdreadreamDreamcatherdreamlikedressdresserdriftdriftwooddripdropletsdubbertducourtiouxduetdustdutchdutydwdwaynedynamiceeaglesearthebbecessiveechoeseclipseeddaedgaredgeeditionedoardoeffectegartnerEghosaegleegoeighteigirdasekhielelaborationelahehelannaelderelderlyelectraelectricityelectrifyelectroniceleganceelenaeleousaelephanteleutheriaelevatedelg3eliaselizabethelleellenelsaembersEmbraceemeraldsemergeemergenceemilie emmaemojiemotionemotionsempapadasemulsionenencausticenchantressendendearmentendlessenergyEngienglishengyentangledentanglementsentelecheiaentereoepepicepisodeeraerelendericerlenderricoESescalatorescalatorsescandeescapeescatescayolaesmeesqueestancoestefestefaniaestudiaestudioestudio de ocresevaevadneyevelynevereverlastingeveryeverydayeveryoneevolvingewaexclutionexhibitionexileexitexodusexoticexoticaexpanseexpansiveexploringexplosionexposedexpressionexpressiveeyeeyeseyeseyeeyraudfabricfacefacenfacesfactoryfaculaefagervikfahrifaifaidrafairfairafairdrafairyfalfafalfanfallfallenfallingfallsfamilyfantasmasfariafarmfarmerfashionfatsefeatheryfebruaryfedelefederfeefeelingfeetfelipfellowsfellowshipfemalefemininefemininityfemmesfemmsfernandaFernandesfernandezfernandoferrariferromanidefeshinafestivalfeverfiberfictionalfiestafiftyFighterfigitalfigurativefigurefiguresfillfinchFindlayfinefine artfionafirefireflyfireworksfirstfischerfishfjordflflameflame of lifeflaotingflavioflavioaguilerafleursflightf loatingfloorflorenciaflowflowerflowersFlowingfluidfluxflyFocusfoleyfolkersfollowfoodfootfootprintforforceforestformformatforstforsterfortressforzefoulFoul-UpfoundfoxfragilityfragmentfragmentationframeframedfrancefranchifranckfrancoisfrancoisefrankFrank Oude Weerninkfrankefransfranzfredrikfreefreezefrenchfreshfriedfertidfriedfertigfriendsfromfrozefrozenfruitfullfull moonfurniturefuryfusionggabrielagabrielegalaxygalegallerygallery 104gallery104gamegapczynskigarciagardengarfgarretgarrettgarrigagarygaspargategatheringgeesiengeishagemgeometricusgeorgegeorge bareccageraniogerigermangermanygesogessoGesusgetgetlostgetsghostgiantgibsongicleegifurativegifurativeartgignacgignilliatgilbertgildedginnagiorgiagiovanygiraffegiraffesgirerdgirlgirlnakedgirlsgirsbergerGiselegiurlgjerdrumglacierglamglassglazeglidingglitchglitterglomgloomyglossgloss finishglossyglowgogobstoppergodsgodshalkgoinggoldgold leafgoldengolden lightgoldilocksgolfgolvengomezgoncalvesgondaliergonegonzaezgordongorinigouachegoutagrace graffitigrafittigraingranslevgranslevngraphicgraphitegraspgrassgravegraygreatgreaygreegreecegreekgreengreenegreygriefgrogrootheddegroundgroupgroup showgrovegrowgulaiangungustavogutierrexgutierrezhHacersehafezhairhaircuthakanhakimhalabburdahalaburdahalehallelujahHamburg ElbphilharmonyhameHanamihandHandlerhandshanghanganhansenhappenedhappinesshappyhardinhareharkinsharmonyharrisharryhartinihashimhaushawaiihawaiianhazehazelnutheadheadingheadshealinghearlandheartheartlandheartsheatheatherHeather LynnHeavenheavensheckheelshegelheidenheightshelgasonhelgesenhellhellfirehellohelp comes fromhelp is on the wayHelp will come from the most peculiar places by Kjerstin JensenhemispherehepburnherherehernandezherndandezhernesheroHFZhihidalgohiddenhidinghieronymushighhildyhilithillhillshistoryhoffmannhohmannhollyholographichomehommehomrighaushonestyhoodhopehorkanhornerhorrorhorsehothotihousehouseshuartehuberthugshulyahumanhumanohumbertohungerhunterhursthustlehutchesonhylyaIi am on youiaiamgeibragimovICi ceIcelandiceyiconiconicid seriesidentidadidomaticifIIIIIiivxiilicilligitimateilluminateillusionilsandimaginativeimagineimagined landscapeinin theIn WaitinceptionindianinessainfinityinflacioningaINga simonyteinggvildinggvildjorgensenIngvildinherentinkink2ink3ink5innerinsideinspiravitinstinctualinsultedintakeinter designinteractionsinterceptioninteriorinterior designinterlockinginternalinternationalinterruptedinterstellarintointrinsecaintrospezioniintrovertinvisibleinvisionioannisiphoneirishiron heartisisaureislaislandsislesisraelitit’sitalyItsits a trapits a trpIVivaivanIvan PiskunovivresseizquierdajjackjacksonJackson pollackJafferjaipeijakejamesJamiejamisonJanejanetjardinjardinsjarosjasonjavierjawjawbonesjaynejazminjazzjejeanjeepersjeffreyjeipeijelenajellyjenjirawatjenniferjensenjeremyjesusjetjettejiapeijiejilljillkellerjimjim farmerjimenezjiminexjiminezjjjljoannaJoannejocelynjochenjoejoellejohjohanssonjohnjohnsonjohnssonjoinjolantajolimontjonasjonas raiderjorgensenjorndtjoshjoshuajouj ourneyjoyjuanJuan PrimerajuditjudithJudith Lindbloomjuliejulijanajulyджунглибарахлопросто расслабьсясправедливостьJustinjwkk99kaczmarczykkalkaleidoscopeKaltrinakaltrina hotikamdarkamran azimkanekaolkariKarinkarlonaitekarlovakkarwowskakarwowzkakatavickaterinakaterina hotikatiekatjakazakhstankellerKerrikerstinkevinkheikhoshabakiernozyckakim robertskingkingdomkingskirschkisskisseskitchenkitekjerstinklachkinklinkknagsKnautkneesknightknowledgekobarikoberkolderupkoppkosterkrakenkraskowskikristinkristinakrivosheeckrivosheevkrystiankrystleKSkuebelkupinakurtkylellaLa Maison de la Rue Sans Nomlaborlabyrinthlacladderladylagoonlagunalaguna beachlakelalalaldylana londonlancelandlandscapelanguagelanzollalargelarsenlaruelashondalassithiotakislassitudelastlastdayslatelatinlatinalaugischlaundrylauralaurellaurenlaurencelaurielaurnecelavalawhornlawrencelaynelazyleleafleandroleaopardleatherledleenaleftleftoversLeganlegerlegercolorlenlenalenoardoleonardleonardoleopardlesLESLIEletletourneauletslettinglewisLeyssyliliberationlidslielienzolietaievalifelifestylelifetoneslightlight uplightboxlightnesslightslights uplikelikelylilianali llieslilylimacherlimitedlimited editionlinalindberglindbloomlineLineslingerlionlipslipsticklisalisasliselenalistlistenlisteninglisylitofflittlelivelivingliving chairliving roomlizljupkaljupkamiticllanalluislmlobsterlocalochlocherloinlollipoplollipopslondonlonelinesslonglonlinesslooklookinglorilos angelesloselosslostlouloudloudenslagerloungelounge chairlouvrelovelove is madnesslove seatlovedlovelastloversloveslovesahlovinglovislowlsfylubanskyLucero Mundolucyluisluminouslunarlustrousluxluxuryluxury rolllvonlyelynnlynn letourneaulysmMacchiamachinemadMadamemadelinemadhousemadicmadisonMadonnamads hoffmanmagdamagdalenamagentamagicmagicalmagicermagnificentmahammedmai kobayashimaikovamaisonMajesticmalemalgosiamalikmalinmammalmammothmanmanchamandmangelsenmanifestingmansmanuelaManuela Karin KnautmanuscriptmanymanzonmaplemarcmarcusmaremariaMaria Victoria checamariahmariangelesmariannemarianomarilynmarinamarinimariomarkmarkermarlonmarmalademaroonmarquezmars moon groundmarshallmarte lua terramartin martinezmarymarzabalmaschiettomaskmaskedmastmasternakmastersmathmatimattermatthewmauramaureenmauriciomavesmaximomaxsonmaymazemazonmazouzmcclozkeymckennamemeaningmediamedinameditationmediterraneemedranomedusameetmeetingmeganmeghanmeimeiermeijdenmejiamelaniemelissamelissaamellowMementoMemento Mori aka ad VerbummemoirsmemoriesmemorymenmenardmermaidsmertanenmetalmetallicmetrometropolisMexican artistmexicomexico citymiamiamimichelemichellemichelle fountainmichielmickmidmid centurymid-mid-centurymidstmieluMigrationmiguelmikamikaelmilamilanmilburnmillermillionsmimmindmindsetmineminimalmiraMirimirjammirrormismiserymisplacedmissingmistmistakeMistedMisted Glowmistrymitakemiticmixmixedmixed mediamixed media on canvasmmmoaimodelmodermodernmodernartmodernsmodernworldmohamedmohammedmoleculesmommomentmomentomomentsmonamona3monalisamonetmonicamonitorsmonkeymonochromeMonotony of WorkmonroemonstermontaukmonthlymonumentalMoodmoonmooremoosemoremorimorningmorningsMoroccanmorrisonmoshmoshnikovamossmostmothe rmotionmottMountmountainmotionmovingmrmugshotmujeresmukhamummurciamusicmusicianmusiciansmvmxmmmymy name is sirimyfanwymyselfmysteriousmysticn. 29n.3nanadinenakainakaiknakednaked truthnamenandininannanapnatnatasanatenathalienaturalnaturcanismenaturenaturennaunavarretenavynebulaneighborsnelinaNelina Moshnikovanelsonneonneptunenessnetsneutralnewnew yearsNew YorkNew York artnew york artistNew York BlueNew York citynewynewyorknfnicenicholasnicinicknickellnicolenightnightmaresnikolasnileningfeininkovicninkovikninnanannaninonipatnitenono 100106no titleno title 2no.nocturnenocturnesnoggenomnoonnordtkenordykenorthernnosenotnotenothinnothingnovellanownoxnuclearnudenumbernunsnursenurturenynyanya gallerynyco sullivanOBobscuredobserverobservingoceaoceanocheroctavianocularodessaodorofoffofferedofficeoffice chairoffice deskofficeroftranscendenceoiloil on canvasoil paintingojookavangooksavikoldoleoolgaolgafeshinaoliviaolsoomonon canvasonautumonaxepiteriaoneoneiroonesopenopen dooropinionoppositesororangeorange countyorgangeorganicorgankranzchenorginalorianeorientaloriginaoriginaloriginal artoriginal art workoriginal artworkoriginal paintingosbu rgoscarosloosterlohosullivanotenasekotherothersotranscendenceouelletteoumamiouroutoutrageOutsideovalovalleoveroverflowovershadowoxidationoz vanrosenO’FarrillpabloPablo LlanapacificpaepageantrypaillardPainpainitngpaintpaintingpainting with no meaningpainting5paintingprintpaintingspaipeipaisajepaitiningpaitnerpaitningpalesepaliwalpallottapalm springspalmerPanagiotopoulospanchopandapanepanelpanelspanichipanitningpantherpantspaolapaoloapaperparaparadiseparadoxparallaxparamipardoparisparkparlorparralaxpartpartnepartnerpartrspartspasqualinipassagepassespassingpassionpassionatepastepastelpatchedpatchworkpathpatriciapatrickPaupaulpaulapavementpayampayenpazpeacepeacefulpeacockpeakpecoraroPedazospeelpelczynskipenpencilpencil\peoplepepepeperperperchedperfectperiPermeateperseverancepersonpersonaperspectivaperspectivepetarpeterpeter foesterspetitpetitephelanpheuilphilanaphilbinphilinaphilippaphilippephoenixphogotaphicphonephotophotographphotographicphotographyphotoshopphysicalitypicassopicnicpicnic kingpicturepiecepiecespietragapigmalgamationpigmentpilgrimpillpine boardpinkpink skypinnaclePipinpirouettePiskunovpitplaceplainsplanetplansplantaeplayplayaplayersplexi glassplouffepodcastpointpointingpointspoisepolandpolar bearpolentaPolinapolymerpondpond iiponytailpoolpoorpopartpoplarspoppiesportalportalsportraitpostcardspostemapotenciapotentiapourpowerpowerfulpranceprancypreparationsprespresnellprestonprezprezgpriceprietoprimaryprimordialprinceprincessprintprintingprobablyprocessprofileprometheuspromisepucapullingpunampuppypurepurplepuzzleqajarquarryquartzqueenquicksandracbarrachaelrachelradtkeraeannerafrafarafaelarafaellaraheemrainRainbowraindroprainerRainfallrainstormrainyranchorandyrandy vandermayrankinravbarrawrawlinsraymondraysrerealismrealityreallyrebelrebuildingrectabglerectangleredredblueredemptionredereredpurpleredwhiteredwoodsreedreflectionreflectionsreflections on the calla lilyregardregnumregresoreifreinfeldrelaxrelaxedreleasereligionreligious artremediesrememberingremnan tremnantsrenelrenewalrepresentationrepressionReschetizkarescueresinresistancerestiveretroreturnrevelationrevolutionreyesrhapsodyriccardoricepaperrichriddlerijikrikkerinerinetterinetteandreasenrippedripplesriseritariverrlroadroadsrobertroberto AlbertorobertsonrobesrobinsonrockrockyrofirojarojorolfirollingROLNICKromanronaldroofroomrootsrosrosaroseRoselinerosemaryrosesrougeroundroundedrouteroversiRoxanne buesoroxiereruinousrunruotolorupprushrussellrussorustrusty blue tavernrutherfordryanryhthmrythmssabinesachasacredsadsadafsaeverudsaidsaidisalesalliesalomesalutationssalvadorsampysandsandrsandraSangiesansSantasantossarasara zahersarahsatryansaturdaysaunderssavannahsavesaveoursavonuzzisavorsayakasayerssaysscapescaryscatteredschairerschcolnicovschiavonschiffschoolschumacherschuttfortscinskasscottscott wilkesscreamingscribblesculptedsculptureseasearchseasseasonsseatseatedsecretsedseductiveseeseeingsefseilerselectricselfsemsemaforosenesiseparationseperationseptemberserengetisergioserieseriesse tlanasettlementsevciksevensevilleshadesshadowShahinashamanovshambalashameshammashammatheshangshapeshapesshapismsharonshawnshesheltersshelvesshersherpasherryshichengshigeyoshishipbreakshoesshoesheelsshopshorelineshoretonesshowshow in galleryshysicadasidesidrahsiestasighsignsign upsignorsilbersilencesilentSilhouettesiliconsilversimilaritiessimonsimonasimonytesimplesimplicitysinsinatrasinghsirakaniansirensirenessirenssittingskeggsskeggsprintskeisketchskinskinnyskirtskullskullsskySlaouisleepslenderslimslosiarsloventoslowlyslumberslumberssmellsmilesmithsmokesnailssneakersnezanaSnowSnowysosoaressobresocialsofiaSoft pastelssoldiersomesomebodysomedaysomethingsometimessometimesitsomniumson’ssoniaSootheSophiasophiesopkosoulsouldssoulssoupsoursourcesouthsoyspacespainspanishspanish artistsparksspatialspeakingspectaclespectivespencerspiralspiralsspiritspiritedspiritualspivacksplashspotsprayspray paintspreadspringsquaresquaressrinivasanssssculptureststairsstaisfactionstallionstanistanleystarestaricn ystarlingstarsstartstatestatementstatuestatuesquestavostealingstefstefan schiftstefaniestefanostencilstengadestepstephaniesterlingstevestillstonestonewarestoragestorestormstorystrangestraumestreamstreamsstreetstretchedstretchingstrongstructurestructuresstrumminstrumminalongstudiostudystylestyrenestyxsubwaysummersummer. weathersummerweathersunsunlightsunrisesunrise at the lakesunsetsunset boulevardsuntonessupernovasuppersursurfsurfacesurrealsurrendersurrendertosurroundsusansusannesuspendedsutdiosuzannesuziesvanasasvetlanaswapsswarmingswarovskisweatsswedensweetsweptswingingsymboltableTadastahiratahseentaimuritaketakentakestaletalltamaratantangenttartertaylorstcteatealtearstechTechniqueteenageteethtelltempertemptresstengotensiontepedinotequilateresaterratesttextiletextureththaddeusthaisthanthanksthatthatarethatbloomthethe endthe mindsetthe summer silencetheiyathelastthentheotherapytherethickthightthinthingthingsthinkthinkingthirdthisthomasthomasgranthornethorntonthorsteinnthoughtthoughtpri ntsthrasherthreethresholdthronethroughtitiberioTibetantidetiefgangtiestigertigresstimetimelapsetimestimes squaretinatinytirbaltiredtitletitretotodaytogethertoilettoitstommytomorrowtomzigtondratonitoptorustoscatouchedtourbillontowtowardstowntrackstraffictrailtraintramontintrancetranscendencetransformtransformationtransitiontrappedtrapped no 1trashtravelingtraversetreatstrecktreetreestreeswoodstriantostribaltribetrimtromblytruetrumpettrustedtruthtsonistsourapastubtuckedtudotulipturbulenceturnturquoisetuumtv standtweedtwigtwilighttwinstwistedtwotwomeytylertylerwebbtzedakisuccidereudiultraviloetultravioletumaimaununaunableunbearableuncannyuncontrivedunderundergroundunderneathunderwaterunentitledunicornuniqueuniverseunknownunountitleduntitled 3untittleunusualUnveilingupupdraftuponupsideuptownurbanurbanaurbanomurdanetaurdentaurehtaneurethaneusvvavacancyvadymvairaValentinavalerieValerie zemanvanvandermeyvanessavanitiravariationvasevasilyvasovayavazheninveilsvekenvenezuelaventedvenusveraVerbum вероникавероникверсусVIвиадуквибвибрациявиккивикториявидавиеVIIviiдеревнявиллямежанвинтажвинилвиолафиолетовыйдевственницавидениевискерпустотавулканвулканволкаволутевонвихрьвихривравранкxvsvsvuelvevvwabewadaswadewaglewagnerwahlborgwaitwalkwalkingwalkingwalliswalliswallwallswallswalpurgiswangenскладводатеплыйтоннамытьебыло это прошедшее мимо. 5watercolorwatercoorwaterfallwaterswatsonwattrewattywavewaveswaxwaywaysWaywardWeweatherwebbwebbingsweinbergweismanwelcomewellwengerwerewestwesterwesternwetwhaleswharfwhatwhatswheelwhenwherewhichwhisperwhisperingwhitewhiteheadwhitingwhitneywhowhyWildwilkersonwillwillemswilliamswilsonwindwindellwindingwindowwindowswinterwinter’swirewisewithwithinwithoutwolffwomanwomandwomanlwomanswomanthaiswomenwonwonderwonderlandwontwoodwoodenwooden panelwoodswoohyunwordwordsworkworldwrapwraywreckagewriting deskwuxxanaxxixianxiiiXIVxtrayankeesyasiniyearsyellowyesyesicayoavYoav breneryoderyogayonkersyorkyosemiteyoshiyouyoungyouryourselfYupoyuriyyvanyvonnezabotinZacaffeinezachzaherZaicikaszaidizarduccizdenkazdenka 1zecheruzempzenzestzestwithinZhadkozhangzhaozhouZikzakzivkoviczlatkoviczoizolotnitskyzonezoranzvezdnaya

Сортировать по ПопулярныеЛучшие продажиПо алфавиту, от A до ZПо алфавиту, от Z до AЦена, от низкой к высокойЦена, от высокой к низкойДата, от новой к старойДата, от старой к новой

«Blue Mystic» Юлианы Равбар, холст, акрил

Галерея 104

Обычная цена 3500,00 долларов США

«Взрыв радости» Юлианы Равбар, холст, акрил

Галерея 104

Обычная цена 1800,00 долларов США

«Волшебный момент 2» Юлианы Равбар, холст, акрил

Галерея 104

Обычная цена $580. 00

JULIANA TRAIL: этап 9 Подбрдо

__data.title__

ВидеоФото: {автор_источник}

Сцена проведет нас через солнечные и волшебные альпийские деревни высоко над Башка Грапа, скрытые для большинства посетителей, путешествующих по дороге и железной дороге в нижней части долины.

Трудно

Расстояние 17,5 км

Продолжительность 6: 30 ч

Ascent1,008 M

ONCENT1,226 M

Высокая точка 998 M

Самая низкая точка 273 м

от Podbrdo, We Accende Tales через село Тртник. Мы начинаем наше путешествие через альпийские деревни на другой стороне перевала Каларско брдо. Первые две деревни, Каль и Стржишче, были колонизированы тирольцами. Вместе с соседними Рут и Грант, Сорица и Немшки Ровт они были основаны иммигрантами из Иннихена в Пустертале. Мы продолжаем путь через заброшенное Зноеле в Облоке по маршруту знаменитого горного марафона «Четыре муниципалитета». По этому маршруту когда-то проходил и кубок мира. Немного спустившись с Облока, продолжаем движение по старой дороге, которая была основным каналом связи через долину. Продолжаем путь до поселка Зараковец и спускаемся в Бачу, Коритницу в Грахово-об-Бачи, где заканчивается этап.

Деревни Коритница и Грахово были основными местами действия первого словенского фильма «На своей земле». Этот период отмечен и памятной туристической тропой, оборудованной информационными пунктами и сценами из фильма.

Этап является одним из самых красивых участков тропы, потому что он проходит по заброшенным тропинкам над Башка Грапа через небольшие деревни, где мы можем встретить очень гостеприимных местных жителей.

Автор

Юлийске Альпе

Update: May 11, 2022

Asphalt 15.29%Dirt road 25.59%Path 50.12%Unknown 8.98%

Asphalt

2.7 km

Dirt road

4.5 km

Path

8.8 km

Unknown

1,6 км

Показать профиль высот

ПЕЧАТЬ — Кал, 819 м

В некоторых местах плохой прием телефона.

Рекомендуется нормальный уровень осторожности, особых опасностей на пути нет.

Зимой все этапы Юлианской тропы от Подбрдо до Бовца непроходимы по снегу, но если погода сухая (обычно до конца декабря или с марта), тропа очень хороша.

Подсказка национального парка Триглав: Долина реки Бача: Башка грапа

Долина реки Бача, называемая Башка Грапа на словенском языке, представляет собой местность с пересеченной и гористой местностью, которая образовалась на геологически разнообразной породе. В геологическом прошлом этот район подвергался эрозионной силе Бачи и ее притоков, а также трансформациям массивных ледников, отступающих с Нижнего Бохиньского горного массива (Сподне-Бохиньское горо).

Проточная вода вырыла узкие долины, или виноградники, с крутыми склонами со средним уклоном около 35 градусов. Поскольку воды много, местность изобилует родниками, оврагами, желобами, водопадами и каскадами. Скалистые склоны оживлены крошечными и хрупкими звездчатыми цветками песчанки с короткими волосами, которая является эндемичной для этих мест.

 

www.julijske-alpe.si

www.dolina-soce.si

www.outdoor-slovenia.si

Автостоянка над железнодорожной станцией в Грахово.

Пешая прогулка по отмеченной туристической тропе, ведущей к Чрна прст, из Подбрдо приводит нас в Каларско брдо; продолжайте движение в Облоке по горному марафону четырех муниципалитетов (GM40) и через леса над региональной дорогой, затем вдоль реки Бача до конца этапа. Маршрут начинается в Подбрдо, у моста через реку Бача, который ведет к железнодорожной станции. Каларско брдо (двухчасовой подъем) можно пройти по туристической тропе до Чрна прст, от перевала продолжить по лесной дороге до Кала и Стржишче. Среди домов под церковью мы спускаемся к нижнему краю лугов под деревней, где находим тропу, ведущую через заброшенную деревню Зноеле в Облоке. Продолжаем движение по трассе GM40 от Каларско брдо до Облоке. На другой стороне Облоке есть тропа, которая ведет нас к небольшому холму, где мы спускаемся к «старой дороге», которая через два километра приводит нас в Зараковец. Там мы можем перейти дорогу и спуститься к реке Бача на другой стороне. Продолжаем движение по подъездной дороге к малой ГЭС к машинному цеху, откуда поднимаемся обратно на главную дорогу. Продолжайте движение по дороге к первым домам, где слева есть небольшой уклон, ведущий к реке Коритница. На другой стороне моста есть тропа, которая ведет нас вдоль реки Бача к Грахово-об-Баче, что является концом этого этапа.

Сядьте на поезд из Любляны или Филлаха в Есенице, Блед, Бохиньска-Бистрицу и Подбрдо.

Автопоезд также курсирует по маршруту Бохиньска Бистрица – Подбрдо – Мост-на-Сочи.

 

Дорога регионального значения:

Любляна – Шкофья Лока – Петрово Брдо – Подбрдо

Мост-на-Сочи – Подбрдо

Автостоянка у железнодорожного вокзала в Подбрдо.

Автостоянка над железнодорожной станцией в Грахово.

ДД

46.214845, 13.974105

DMS

46 ° 12’53,4 «n 13 ° 58’26,8» E

UTM

33T 420870 5118430

W3W

///curves. sifts.slashed

77 //curves.sifts.slashed

777 //curves.sifts.slashed

7 Показать на карте

Походное снаряжение по сезону.

__(функция () { if (data.x != null) { return ((data.x*1000.0)).toFixed(typeof data.digits === ‘number’ ? data.digits : 1) } else { return ‘–’ }})()__ mm

__(функция () { if (data.x != null) { return ((data.x*100.0)).toFixed(typeof data.digits === ‘ число’ ? data.digits : 0) } else { return ‘–’ }})()__ cm

__(функция () { if (data.x!= null) { return ((data.x*0.001)).toFixed(typeof data.digits === ‘number’ ? data.digits: 1) } else { return ‘–’ }})()__ km

__(function () { if (data.x != null) { return (data.x).toFixed(typeof data.digits === ‘number’ ? data.digits : 0) } else { return ‘–’ }})()__ m

__(function () { if (data.x != null) { return (data.x).toFixed(typeof data. цифры === ‘число’ ? data.x). toFixed(typeof data.digits === ‘number’ ? data.digits : 0) } else { return ‘–’ }})()__

__(функция () { if (data.x!= null) { return ((data.x*1000.0)).toFixed(typeof data.digits === ‘number’ ? data.digits: 1) } else { return ‘–’ }})()__

__(функция () { if (data.x != null) { return ((data.x*100.0)).toFixed(typeof data.digits === ‘ число’ ? data.digits : 0) } else { return ‘–’ }})()__

__(функция () { if (data.x != null) { return ((data.x*0.001)) .toFixed(typeof data.digits === ‘number’ ? data.digits : 1) } else { return ‘–’ }})()__

__(function () { if (data.x != null) { return (data.x).toFixed(typeof data.digits === ‘number’ ? data.digits : 0) } else { return ‘–’ }})()__

__(функция () { if (data.x != null) { return (data.x).toFixed(typeof data.digits === ‘number’ ? data.digits : 1) } else { return ‘– ‘ }})()__

__(функция () { if (data.x != null) { return (data.x)} else { return data }})()__

__(function () { if (data.x != null) { return ((data. x*1000.0))} ​​else { return data }})()__

__(function () { if (data.x != null) { return ((data.x*100.0))} ​​else { вернуть данные }})()__

__(функция () { if (data.x != null) { return ((data.x*0.001))} else { возвращаем данные }})()__

__(функция () { if (data.x != null) { return (data.x)} else { return data }})()__

__(function () { if (data.x != null) { return (data.x)} else { return data }})()__

{значение} ч:мин

{значение} ч

{значение} часов

{0,дата,ММММ дд}

{0,дата,ММММ дд, гггг}

{0,время,ЧЧ:мм}, {0,дата,ММ/дд}

{0,время,ЧЧ:мм}

{0}ч

{0}ч

Одна минута назад

{0} минут назад

час назад

{0} часов назад

Один день назад

{0} дней назад

{0,дата,ММ-дд-гггг}

{ «relativeDays»: { «0»: «Сегодня», «-1»: «Вчера», «-2»: «2 дня назад» }}

__alp.i.weatherbox.renderBoxCol(данные, 0, 1)__

__alp.i.weatherbox. renderBoxCol(данные, 1, 4)__ ​​

Что мешает цифровой трансформации предприятия?

— Бизнес-советы

Цифровая трансформация означает использование новейших доступных технологий для разработки процессов и/или продуктов таким образом, чтобы максимально повысить эффективность использования компанией своих ресурсов. Это широкое понятие, которое охватывает не только конкретную отрасль, но и большой сегмент общества, включая правительство, здравоохранение, розничную торговлю, образование, транспорт, производство и ИТ.

Некоторые компании считают, что их организация недостаточно подготовлена ​​или не готова к цифровой трансформации. Некоторые компании ограничивают свои стратегии и бизнес-процессы традиционными методами, поскольку не знают о преимуществах и возможностях цифровых технологий. Некоторые другие предприятия избегают внедрения передовых технологий, полагая, что это может быть дорогостоящим делом. Многим компаниям не хватает доходов и ресурсов для внедрения цифровой трансформации. Некоторые организации сопротивляются изменениям. Владельцы предприятий довольны существующими стратегиями и не стремятся внедрять новые технологии в свои бизнес-процессы.

Путь к цифровому преобразованию не гладкий, существует множество проблем, с которыми сталкивается предприятие, адаптируясь к этим изменениям. Давайте выясним, какие серьезные проблемы мешают учреждениям воспользоваться преимуществами цифровой трансформации . Вот список из трех основных проблем:

Отсутствие доступности

Возможно, технология недоступна для учреждения из-за отсутствия знаний или сопротивления со стороны политиков. Расположение предприятия играет важную роль в обеспечении того, будут ли ресурсы доступны предприятию или нет. В отчете, опубликованном Booz & Company в 2013 году, было четко указано, что влияние цифровизации неравномерно, и некоторые отрасли в одних странах получают доступ к этим технологиям с большей готовностью, чем другие. Времена не сильно изменились, когда дело доходит до цифровой трансформации. Многие организации до сих пор не знают о преимуществах цифровой трансформации.

Проблемы с репутацией и безопасностью

Многие руководители серьезно обеспокоены безопасностью данных своих клиентов, что также вполне оправданно. Согласно исследованию, проведенному Capgemini в 2011 году, 47 % опрошенных руководителей были обеспокоены тем, что их инициатива по оцифровке может столкнуться с препятствиями со стороны регулирующего органа. Такие отрасли, как здравоохранение и поставщики финансовых услуг, очень осторожны в отношении утечки данных, которая может произойти из-за попытки взлома. Это связано с тем, что их репутация очень тесно связана с конфиденциальностью информации их клиентов. ИТ-отделы несут ответственность за обеспечение безопасности данных и конфиденциальной информации.

Недостаток квалифицированных кадров

Во многих отраслях, несмотря на то, что работники обладают необходимыми навыками, они используют свои профессиональные и основанные на опыте суждения при принятии решений. В некоторых организациях может не быть квалифицированных и хорошо оснащенных сотрудников, которые могли бы принять цифровую трансформацию. Оцифровка всей системы становится радикальным изменением, поскольку у сотрудников отсутствуют базовые знания об использовании компьютеров. Обучение этих сотрудников с нуля может привести к простоям и инвестициям в обучение; это даже не гарантирует, что преобразование будет принято всеми.

Вышеупомянутые причины являются основными проблемами, с которыми сталкивается организация в процессе цифровой трансформации. В 2015 году Всемирный экономический форум с помощью Accenture провел исследование, чтобы проанализировать влияние цифровизации. В промежуточном отчете исследования утверждается, что цифровая трансформация может принести 100 триллионов долларов не только предприятиям, но и обществу в целом в течение следующего десятилетия.

Как предприятия могут осуществить цифровую трансформацию?

У нас не должно быть никаких сомнений в том, что цифровая трансформация абсолютно необходима и должна осуществляться в действительно хорошем темпе. Эта технология гарантирует, что существует много возможностей и возможностей, но оцифровка находится только на ранней стадии. Организации должны проявлять инициативу, чтобы убедиться, что они не остались незатронутыми технологическим влиянием, которое получают другие в развитом мире.

Чтобы процесс цифровой трансформации был успешным, предприятия должны быть открыты для новых развивающихся технологий. Вы не можете просто инвестировать в технологии и ожидать, что все ваши сотрудники начнут их использовать. ИТ-отделы должны подготовиться и искать новые способы внедрения инноваций в свои процессы. Первоначальное внедрение стратегий цифровой трансформации может потребовать некоторого обучения членов команды. Владельцы бизнеса и заинтересованные стороны должны приветствовать все, от регулирования старых политик до принятия новых стратегий, чтобы обеспечить рост бизнеса. Тщательное рассмотрение, стратегическая дорожная карта и единый опыт необходимы для осуществления цифровой трансформации.

По теме – Как большие данные и искусственный интеллект меняют облик электронной коммерции

По мере того, как интерес к цифровым преобразованиям продолжает расти, мы можем ожидать, что все больше и больше предприятий будут их внедрять. Большие данные, искусственный интеллект и Интернет вещей уже стали неотъемлемыми частями нашей жизни. Отраслевые эксперты ожидают, что в следующем десятилетии средние и крупные предприятия примут цифровую трансформацию. Давайте подождем и посмотрим, что эта современная технология привнесет в разные отраслевые вертикали. На данный момент мы можем сказать, что цифровая трансформация изменит правила игры для предприятий любого размера.


Биография автора: —

Кристи Дэвис — менеджер по маркетингу в i-Verve Inc, инновационной компании по развитию электронной коммерции для веб-сайтов и мобильных платформ. Она отвечает за коммуникации, маркетинг и развитие бизнеса компании. Помимо ответственности за стратегическое развитие бизнеса, она занимается брендингом, связями со СМИ и рекламой. Кристи также направляет и управляет спонсорством, обучением маркетингу и мероприятиями в компании. Она занимала различные высокие должности в маркетинговой индустрии. Когда она не творит чудеса за своим столом, вы, вероятно, застанете ее исследующей природу, пробирающейся через Лейквью и лучшую кухню Ригливилля и его окрестностей, или катающейся по Вестерн-авеню. Ее камера редко покидает ее.

Коммерческое, корпоративное право и M&A в Сербии

BDK Advokati AOD

Корпоративная группа BDK Advokati AOD постоянно пользуется спросом у клиентов, открывающих свое присутствие в Сербии, в то время как команда по слияниям и поглощениям регулярно оказывает помощь в проведении сделок, а также консультирует и спорная работа. Практика также консультирует по вопросам корпоративного управления, корпоративных финансов, увеличения капитала, обмена долга на капитал, сокращения капитала и ликвидации. Руководитель практики слияний и поглощений Владимир Дашич имеет многолетний опыт участия в крупных региональных сделках; Тияна Койович — эксперт по сделкам; и Томислав Попович является ключевым советником. Опыт юриста Елены Зеленбабы включает в себя сделки по приобретению с участием как зарегистрированных на бирже, так и частных компаний в качестве целей.

Руководитель практики:

Владимир Дашич; Тияна Койович; Томислав Попович

Другие ключевые юристы:

Елена Зеленбаба

Отзывы

Команда очень отзывчива и предана своим проектам.

Люди, которые хорошо осведомлены, умны и ориентированы на поиск решений.

Исключительный подход с дальновидными и практичными решениями для коммерческих вопросов и сделок M&A.

Признанные лидеры рынка.

Мне нравится практичный и эффективный подход команды к управлению проектами, они быстро и активно предлагают решения – я думаю, что это их сильные стороны и то, что ищет каждый клиент.

Владимир Дашич имеет большой опыт в сделках по слияниям и поглощениям и отлично руководит и поддерживает свою команду.

Владимир Дашич – выдающийся специалист по сделкам, ориентированный на поиск решений и дальновидный юрист, обладающий глубоким знанием рынка и людей.

Елена Зеленбаба – замечательный и преданный своему делу член команды, которая отлично справляется со сложными проектами в нескольких юрисдикциях.

Key clients

Google

British American Tobacco

BBC

Froneri

Nestor Advisors

Refisa

Clearstream

DUAL Deutschland

BIC Slovakia

Augmenta

Nomad foods

ADM

Группа объятий

Frontier Pharma

Affidea Diagnostic

Ellis Enterprises East

China Road and Bridge Corporation

Основные моменты работы
  • Помогал Refisa в различных вопросах корпоративного управления.
  • Консультирование Nomad Foods в связи с приобретением бизнес-группы по производству замороженных продуктов Fortenova Group.
  • Консультирование ADM, американской многонациональной корпорации по переработке пищевых продуктов и торговле сырьевыми товарами, в связи с приобретением Sojaprotein, компании по переработке соевых бобов.

JPM Jankovic Popovic Mitic

JPM Jankovic Popovic Mitic В корпоративную команду JPM входят эксперты в области энергетики, телекоммуникаций, финансовых услуг, инфраструктуры и горнодобывающей промышленности. Команда имеет особый опыт работы с несколькими юрисдикциями, включая работу с клиентами из США, Канады и Азии; это также полезная практика по связанным с этим вопросам регулирования, налогообложения и законодательства о конкуренции. Старший партнер Ненад Попович, возглавляющий корпоративный отдел, специализируется на крупных стратегических сделках, а руководитель горнодобывающей и энергетической отрасли Елена Газивода занимается ведущими на рынке проектами. Елена Станкович Лукич также является ключевым партнером, а Аня Шакан и Бояна Яворич — опытными старшими юристами.

Руководитель(и) практики:

Ненад Попович; Елена Газивода

Другие ключевые юристы:

Елена Станкович Лукич; Аня Шакан; Бояна Яворич; Иван Петрович; Никола Джорджевич

Отзывы

Юристы JPM преданы своей работе и предоставляют исключительные юридические услуги.

Они ориентированы на решения, непредубеждены и очень хороши с точки зрения реагирования.

Юристы дают качественные консультации.

Команда JPM выдающаяся во всех аспектах своей работы.

Ненад Попович – ветеран корпоративного права и выдающаяся фигура на сербском юридическом рынке.

Елена Газивода – отличный юрист с прекрасным пониманием коммерческих аспектов сделок и превосходными знаниями в области регулирования и слияний и поглощений.

Елена Газивода имеет подтвержденный опыт работы в качестве ведущего партнера по крупным сделкам в энергетическом секторе, и она очень отзывчива и профессиональна.

Елена Станкович Лукич исключительно дотошна, прагматична и ориентирована на клиента.

Key clients

MTU Aero Engines

Gastrans

Rolls Royce & Partners Finance

Panasonic Corporation

Karlovarské minerální vody

Adventura Holding

Decathlon

Cerved Credit Management Group

China Shandong International Economic & Группа технического сотрудничества

JP Srbijagas

Transportgas Srbija

Victoria Group

Balkan Mining and Minerals

Основные моменты работы
  • Консультирование BASF в связи с созданием дочерней компании Star Builders Solutions совместно с Lone Builders Solutions doo Beograd.
  • Консультирование Deceuninck по вопросам продажи дочерней компании в Сербии и налаживания эксклюзивного сотрудничества в области распространения и лицензирования товарных знаков с приобретающей сербской компанией.
  • Консультирование двух дочерних компаний PT Indofood CBP Sukses Makmur Tbk по вопросам должной осмотрительности и другим вопросам, связанным с непрямым приобретением Pinehill Co, которое затронуло восемь различных юрисдикций.

Karanovic & Partners

Большая корпоративная и коммерческая команда Karanovic & Partners регулярно участвует в крупных сделках в Сербии, и фирма регулярно использует опыт юристов из разных юрисдикций, включая Хорватию, Словению, Черногорию, Северную Македонию и Боснию и Герцеговина. Драган Каранович возглавляет группу, в которую также входят специалист по возобновляемым источникам энергии и праву горнодобывающей промышленности Милош Вучкович и Марьян Поляк, которые регулярно консультируют по крупным сделкам по слияниям и поглощениям. Другими уважаемыми партнерами являются Милош Яковлевич, Иван Нонкович и Горан Радошевич, а Сава Драча, Игорь Радованович и Марко Чулафич – опытные старшие юристы.

Руководитель(и) практики:

Драган Каранович; Милош Вучкович; Марьян Поляк

Другие ключевые юристы:

Милош Яковлевич; Иван Нонкович; Горан Радошевич; Сава Драча; Игорь Радованович; Marko Ćulafić

Отзывы

Хорошо укомплектованная фирма с опытными экспертами во всех областях.

Я очень доволен услугами, которые они предоставили до сих пор, поскольку их юристы продемонстрировали безупречное понимание рынка слияний и поглощений и предложили практические решения для корпоративных вопросов.

Их глубокое знание конкретных отраслей является одним из их самых сильных активов.

Марьян Поляк имеет исключительную доступность.

Иван Нонкович является одним из ведущих юристов на рынке слияний и поглощений – он прекрасно разбирается в банковской сфере и способен предложить исключительные и креативные решения для самых сложных вопросов, что для нас чрезвычайно важно.

Ключевые клиенты

Pfizer

Take Two

Mars Serbia

Carlyle Group

Mid Europa Partners

Digital Serbia Initiative

Inditex Group

Sanofi

Medigroup

Affidea

Wolt

DPE Deutsche Private Equity

Work highlights
  • Консультировал Take Two в связи с приобретением Nordeus, белградской компании по производству мобильных игр.
  • Консультирование Ясмины Кнежевич и Милана Кнежевич, основателей Bel Medic, в связи с их соглашением о продаже 70% акций Bel Medic и партнерстве с Acibadem Healthcare Group.
  • В сотрудничестве с другими юридическими фирмами консультировал Pfizer по вопросам разделения бизнеса Upjohn в Сербии, Хорватии, Словении, Черногории, Северной Македонии и Боснии и Герцеговине.

Moravcevic Vojnovic and Partners в сотрудничестве с Schoenherr

В дополнение к своему богатому опыту в области банковских слияний и поглощений, Moravcevic Vojnovic and Partners в сотрудничестве с корпоративной и коммерческой практикой Schoenherr регулярно консультирует по сделкам, связанным со здравоохранением, фармацевтикой и энергетикой. , наряду с крупными инфраструктурными проектами в Сербии и на региональном уровне. Команду возглавляют специалист по слияниям и поглощениям Матия Войнович, которая консультирует стратегических инвесторов и частные инвестиционные компании, и Лука Лопичич, эксперт в области розничной торговли, потребительских товаров, фармацевтики, телекоммуникаций и автомобильного сектора. В практику также входят именной партнер Славен Моравчевич, специалист по корпоративному праву и слияниям и поглощениям Воимир Куртич и главный адвокат Боян Райич.

Руководитель(и) практики:

Матия Войнович; Лука Лопичич

Другие ключевые юристы:

Славен Моравчевич; Воимир Куртич; Боян Райич; Йован Барович

Отзывы

Эта коммерческая, корпоративная практика и практика слияний и поглощений на высшем уровне.

Они очень опытны и обладают действительно обширным опытом, который выходит за рамки решаемой проблемы.

Они не только превосходно справляются со своей задачей, но и предвидят потенциальные проблемы, которые могут возникнуть в будущем, намного лучше, чем подавляющее большинство юрисконсультов, с которыми я работал.

‘Фирма сочетает в себе сильный бренд, международную сеть и стандарты с местным колоритом и приверженностью клиентам.

Матия Войнович сочетает в себе выдающиеся юридические знания с действительно хорошим деловым и коммерческим чутьем и чутьем, что довольно редко встречается в юридической профессии.

Лука Лопичич и Матия Войнович – наш типичный порт захода, и мы очень довольны их качеством обслуживания, уровнем профессионализма и приверженности делу.

И Матия Войнович, и Воимир Куртич – отличные коммуникаторы, и с ними приятно работать.

Воимир Куртич исключительно хорошо справляется со сложными заданиями и выполняет задачи профессионально, коллегиально и в то же время высокопродуктивно.

Ключевые клиенты

Oaktree

Endava

Carlyle Group

Nidec Corporation

Elektroprivreda Srbije

Syneos Health

BM Consulting

Masdar Taaleri Generation

RWE

E ON

Shoppster DOO Beograd

TN Invest Anstalt

Opportunity Transformation Investments

Hleb & Kifle

Work highlights
  • Assisting Rio Tinto with an investment in Сербия, включая возможные вопросы корпоративного структурирования и регулирования.
  • Консультирование корпорации Nidec по вопросам инвестиций в новые производственные мощности в г. Нови-Сад.
  • Консультирование Elektroprivreda Srbije в связи с приобретением 51% акционерного капитала ГЭС Горня Дрина, концессионной проектной компании, созданной для строительства и эксплуатации системы гидроэлектростанций.

Petrikic & Partneri AOD в сотрудничестве с CMS Reich-Rohrwig Hainz

Petrikic & Partneri AOD в сотрудничестве с CMS Reich-Rohrwig Hainz Практика слияний и поглощений, прямых инвестиций, аутсорсинга, реструктуризации и приватизации. секторальный опыт фирмы в банковском деле, энергетике, инфраструктуре, страховании и медико-биологических науках, среди других областей. Возглавляя группу корпоративного права и слияний и поглощений, Радивое Петрикич имеет более чем 25-летний опыт участия в крупных сделках и девелоперских проектах в регионе ЦВЕ; Майя Степанович обладает многолетним опытом работы в сфере корпоративного права, слияний и поглощений и коммерческой деятельности в Сербии; а Мария Тешич консультирует международные компании по вопросам открытия и реструктуризации бизнеса в стране.

Руководитель практики:

Радивое Петрикич

Другие ведущие юристы:

Майя Степанович; Мария Тешич

Отзывы

У нас был очень хороший опыт работы с этой фирмой.

Мария Тешич – очень опытный специалист по сделкам M&A.

Ключевые клиенты

Poseidon Group

Мытиска REIM

Celsius Network

Mainstream

Sportina Group

COFCO International

Ahold Delhaize

LEAR Corporation

Johnson & Johnson

A1 Serbia

Cummins

EchoStar Corporation

CenturyLink

AECOM

Lukoil

Work highlights
  • Advised Britain’s Poseidon Group и бельгийская компания Mitiska REIM о продаже четырех торговых центров в Сербии компании Immofinanz.
  • Консультирование Celsius Network, платформы для получения вознаграждений за криптовалюту, в связи с приобретением MVP Workshop, сербской компании, занимающейся исследованиями и разработками продуктов блокчейна.
  • Оказывал помощь Mainstream, региональному поставщику облачных услуг, в продаже пакетов акций двух компаний.

Bojovic Draškovic Popovic & Partners

Помогая покупателям и продавцам как в открытии, так и в закрытии сделок, Bojovic Draškovic Popovic & Partners занимается сложными трансграничными слияниями и поглощениями, а также местными сделками. Команда также имеет опыт работы в авиационной отрасли. Возглавляя корпоративно-коммерческую практику и практику слияний и поглощений, Вук Драшкович имеет многолетний опыт консультирования по крупнейшим сделкам слияний и поглощений в регионе. Урош Попович имеет квалификацию для работы как в Сербии, так и в США, а Мария Бойович является экспертом в области корпоративного и коммерческого права. Среди старших сотрудников следует отметить Марио Киянович, Милицу Пештерич и Милош Андреевич.

Руководитель(и) практики:

Вук Драшкович

Другие ведущие юристы:

Урош Попович; Мария Бойович; Марио Киянович; Милица Пештерич; Miloš Andrejević

Testimonials

Это исключительная юридическая фирма, которая охватывает все области права.

Высокий уровень профессионализма, исключительное обслуживание клиентов и сотрудничество, разумные расценки и более чем удовлетворительное время отклика.

Фирма активно консультирует нашу компанию по основным вопросам и новым законам и правилам, и они всегда понимают бизнес и приоритеты компании.

Надежная, высокопрофессиональная и гибкая юридическая фирма.

Всегда выполняет работу наилучшим образом.

Они оказались очень умелыми и организованными.

Мария Бойович и Урош Попович обладают высокой квалификацией и высокой квалификацией – очень отзывчивые, стратегически мыслящие и доверенные консультанты, которые эффективно управляют своими командами и обладают глубоким знанием нашего бизнеса и потребностей.

Вук Драшкович и Урош Попович ценятся за профессионализм, гибкость и отзывчивость.

Key clients

The Walt Disney Company

Pepco

Dun & Bradstreet

Turkiye Maarif School

adidas

Philips

AC Nielsen

AerCap Ireland

Cymbria Corporation

EBRD

Work highlights
  • Консультирование Dun & Bradstreet (через международную юридическую фирму) по вопросам соблюдения нормативных требований в странах ЮВЕ в связи с приобретением компании Bisnode, занимающейся данными и аналитикой.
  • Консультирование компании AerCap House (владелец и продавец коммерческих самолетов) по вопросам аренды самолета Airbus 330-200 компании Air Serbia.
  • Оказал Philips помощь в решении вопроса о передаче местного бизнеса.

BOPA Bojanovic & Partners

BOPA Bojanovic & Partners возглавила сеть юридических фирм ЮВЕ, Adriala, которая служит универсальным магазином для клиентов, ведущих бизнес в регионе. В корпоративную и коммерческую команду входят специалисты в области энергетики, инфраструктуры, фармацевтики, здравоохранения и ТМТ, а также в других областях. Возглавляя обширный отдел, Владимир Боянович работает с международными фирмами, в том числе с фирмами Magic и Silver Circle, инвестиционными банками и фондами прямых инвестиций по трансграничным сделкам.

Руководитель(и) практики:

Владимир Боянович

Отзывы

Они предоставляют результаты на уровне крупных международных юридических фирм.

Первый выбор среди всех крупных инвестиционных и прямых фондов.

Ключевое имя для сделок по слияниям и поглощениям, они выполняют одни из самых сложных операций на рынке.

Владимир Боянович – лучшее, что можно найти для работы в области слияний и поглощений – бизнес-ориентированный юрист с практичным подходом к решению сложных вопросов.

Владимир Боянович заработал репутацию лучшего юриста по слияниям и поглощениям на рынке. Он действительно лучший из лучших – лучшего переговорщика я еще не видел.

Владимир Боянович отлично решает проблемы.

Ключевые клиенты

Polhem Infra Kommanditbolag

BMI Group Holdings UK

Asian Sourcing Link

Fevo

Barry Wehmiler

Vodafone0004

Gazprom

Gastrans

General Electrics

Wizz Air

Temas Resources Corp

Team. blue

Alychlo

Work highlights
  • Advised Polhem Infra Kommanditbolag on its acquisition of the Telia Carrier business from Telia Company.
  • Консультирование «Газпрома» по вопросам корпоративной реструктуризации и выхода на рынки пяти стран путем создания газовой сети стоимостью 1,5 млрд евро.
  • Консультирование Team.blue по вопросам приобретения всего акционерного капитала Enartia.

Gecic Law

Gecic Law, одна из самых быстрорастущих фирм на Западных Балканах, имеет широкий список национальных и зарубежных клиентов, включая компании среднего размера, правительства и международные конгломераты. Недавно получивший повышение от старшего юрисконсульта до партнера, руководитель группы Огнен Чолич имеет более чем 15-летний опыт работы как в местных, так и в международных корпоративных сделках и сделках по слиянию и поглощению, энергетике, инфраструктуре и ГЧП, а также в соблюдении нормативных требований; эксперт по конкурентному праву Богдан Гецич также занимается крупными корпоративными сделками. На уровне старшего младшего специалиста Даница Мисойчич является специалистом по корпоративному управлению.

Руководитель(и) практики:

Огнен Цолич; Богдан Гецич

Другие ключевые юристы:

Даница Мисойчич

Отзывы

Предоставляет услуги на самом высоком уровне с очень клиентоориентированным подходом.

Они очень отзывчивы и дают точные юридические консультации, которые касаются сути дела.

Сильная поддержка по корпоративным вопросам, предоставление любой необходимой помощи.

Очень быстро и оперативно реагируют на все новые вызовы на рынке – и они всегда принимают во внимание, что мы региональная компания, которая ведет бизнес в других странах, а не только в Сербии.

Они понимают бизнес и то, что компании должны стать и оставаться успешными. Конечно, они также высокообразованны, часто указывают на юридические проблемы до того, как они возникнут, тем самым помогая нам их избежать.

Огнен Колич – очень ответственный, серьезный профессионал, который полностью отдается своей работе и всегда готов ответить на любой вопрос. Но что действительно выделяется, так это то, что он заботится о нашем бизнесе и о том, что мы успешны — это исключительный сервис, а не просто хороший.

Огнен Чолич очень предан своему делу и очень хорошо понимает бизнес-процессы, и помимо того, что он хорошо образован, он обладает фантастическим опытом.

Богдан Гечич был чрезвычайно полезным. Он выдающийся профессионал и прекрасный юрист, который всегда дает уникальный стратегический взгляд на решение практических юридических вопросов.

Ключевые клиенты

Allied Universal Topco

UGT Renewables

NBT AS

Dalton Technologies

Petrol d d Slovenia

Nutanix

Takenaka

Natural Sciences State Park

FractureCode Corporation

Work highlights
  • Advised NBT AS on the acquisition of a large portfolio of wind projects in Serbia (in partnership с WV International).
  • Консультирование регионального дистрибьютора нефтепродуктов Petrol d d в Словении по сложному делу, касающемуся приобретения им акций сербской компании, которое включало переговоры с продавцом по предполагаемым непогашенным обязательствам по сделке.
  • Консультирование UGT Renewables в связи со сверхкрупномасштабным проектом строительства солнечной электростанции в Сербии.

Harrisons Solicitors

Корпоративная и коммерческая практика Harrisons Solicitors имеет завидный опыт консультирования по крупным приобретениям и продажам в стране. Области заметного недавнего роста варьируются от консультирования начинающих компаний ИТ-сектора до управления крупными инвестициями инвесторов из Абу-Даби в Сербию. Фирма также имеет нишевый опыт в сельскохозяйственной отрасли. Консультант Горан Мартинович имеет многолетний опыт работы в сфере недвижимости, энергетики, корпоративного и коммерческого права, а также консультирования по вопросам слияний и поглощений и сделок с частным капиталом. Наряду со своей практикой в ​​сфере трудового права, старший юрист Елена Асанина активно занимается вопросами корпоративного права.

Руководитель(и) практики:

Горан Мартинович

Другие ключевые юристы:

Елена Асанин

Отзывы

Команда стремится решать вопросы быстро.

Отличное отношение и отличное сотрудничество.

Профессионал, своевременный и отзывчивый, с практическими и теоретическими знаниями.

Стремление сделать все возможное, чтобы найти наилучшее возможное решение и изучить все варианты.

Мой опыт работы с командой Harrisons показывает, что они хорошо осведомлены, сотрудничают и стремятся найти наилучшее возможное решение.

Помимо того, что они открыты для диалога, они понимают бизнес-среду и способны видеть общую картину.

Елена Асанина хорошо осведомлена, с ней легко общаться, она инновационна и имеет позитивный настрой – она добивается положительных результатов.

Ключевые клиенты

Fortenova Grupa

Al Dahra

Cognativ

Summa Labs (Voiceworks)

Arcadis Gen

Integral Group (DAR)

ACRM

Embroker

FCA Serbia

Mondi Packaging

Orgnostic

Quabadger

Sysdig

Al Rawafed

Британский совет

Посольство Великобритании

Citibank

Harsco Metals

Kampster

Seven Bridges Genomics

Spearhead

vast.com

Нежно

EBRD

GateGroup

SR Technics

Visa International

Totient

Gladbrook

Основные работы
  • Advisting Group On The REORGIANSISTIONS OPRINISIASTIONS REORGIANSISIARISTIONS OPRINAINGISTIONS REORGIANISIASTIONS OPRINISIANITIARISTIONS OTSERBIANSISINATION.
  • Консультирование Fortenova Grupa по различным вопросам.
  • Консультирование Al Dahra по вопросам ее повседневной деятельности в Сербии.

Joksovic, Stojanovic & Partners

Joksovic, Stojanovic & Partners постоянно пользуется спросом у крупных корпоративных клиентов благодаря своему опыту работы с крупномасштабными проектами. Практика также консультирует многонациональные компании по вопросам реструктуризации и имеет большой опыт работы как в автомобильной, так и в ИТ-отрасли. Сосредоточившись на корпоративных проектах, слияниях и поглощениях и инвестициях в новые проекты, Милан Йоксович специализируется на международном коммерческом и корпоративном праве, а Петар Стоянович регулярно консультирует по важным проектам как в Сербии, так и в Черногории. Также ключевую роль в практике играют опытные партнеры Срджан Толпа и Горан Вучич, а Тияна Милишич – партнер, которого следует отметить.

Руководитель практики:

Милан Йоксович; Петар Стоянович

Другие ключевые юристы:

Срджан Толпа; Горан Вучич; Тияна Милишич

Отзывы

Очень дружелюбные, тактичные и профессиональные люди.

‘Они хорошо организованы и имеют очень эффективный стиль работы.

Знания команды и понимание рынка огромны.

Это действительно непревзойденные профессионалы и настоящие деловые партнеры для штатных юристов, ведущих бизнес в стране.

Эта команда очень отзывчива, а их ответы кратки и по делу – мы можем положиться на знания и опыт этой команды.

Уникальность этой практики заключается в том, что я, как клиент, на 100% уверен, что требуемая задача будет выполнена вовремя.

Милан Йоксович и Срджан Толпа – выдающиеся партнеры.

Петар Стоянович и Горан Вучич – высококомпетентные и внимательные корпоративные и коммерческие юристы, и их расценки более чем справедливы для предоставляемых ими услуг. Они поддерживали меня во многих сложных и необычных делах в Сербии, и все это привело к успешным результатам для моей компании.

Ключевые клиенты

Robert Bosch

Nelt Group

Развитие инфраструктуры и строительство

BSH Hausgeräte

Scania

General Electric

Panasonic

Meridian Group

Koepfer Group

Renault Nissan

Nokia Solutions and Networks

SSA Pana

BTL Medical Technologis

Raico Bautechnic

Mitros Fleischwaren

Kandussi

Nonnenman

Regent Beleuchtungskörper

Ott-tricot

Pragmatic Play

Merck Sharp & Dohme (MSD)

Teknoxgroup Srbija

GrECo International

Alkemy

Elekta Solutions

Sandvik

Croatia Records

GMG Health

Kepler Interactive

Hermes Pharma

Основные моменты работы
  • Консультирование Kepler Interactive по сербским аспектам приобретения Ebb Software.
  • Консультирование Siemens в связи с выделением подразделения Siemens Flender в Сербии.
  • Консультирование Merck по сербской части глобальной реорганизации.

Адвокатское бюро Мирослав Стоянович в сотрудничестве с Wolf Theiss

Вызов одной из крупнейших команд по корпоративному праву и слияниям и поглощениям в регионе Центральной и Восточной Европы и Юго-Восточной Европы, Адвокатского бюро Мирослава Стояновича в сотрудничестве с Wolf Theiss Недавний опыт включает в себя увеличение числа сделок по слияниям и поглощениям включая ИС и ИТ, а также вопросы здравоохранения. Команда также принимает активное участие в мандатах, связанных с инвестициями в новые проекты, в то время как связанные с банками реструктуризации и приобретения остаются значительными сильными сторонами. Соруководителями команды являются Мирослав Стоянович, который последовательно занимается крупными сделками, и Наташа Лалович-Марич, специалист по консультированию международных клиентов по различным инвестициям в Сербии. Анджелка Тодорович – достойный внимания советник.

Руководитель практики:

Мирослав Стоянович; Наташа Лалович-Марич

Другие ключевые юристы:

Анджелка Тодорович; Александр Ристич; Марияна Зеякович

Отзывы

Команда, ориентированная на обслуживание, с отличными юридическими навыками.

Они хорошо знают, какие проблемы волнуют международных клиентов, поэтому они превосходно описывают местную правовую среду в свете таких вопросов.

Высокопрофессиональный, отзывчивый, деловой человек, с которым приятно работать.

Отличная и знающая команда отличается от многих других юридических фирм, с которыми мы сотрудничаем, очень профессиональным подходом к клиентам, отличными организаторскими способностями и опытом оказания широкого спектра юридических услуг.

20 лет работы над крупными сделками M&A делают их ключевым игроком на рынке.

Выделяются партнеры Наташа Лалович-Марич и Мирослав Стоянович.

Наташа Лалович-Марич отлично разбирается в сделках и ключевых коммерческих драйверах – она всегда доступна и предоставляет отличный сервис.

Александр Ристич очень дотошный.

Ключевые клиенты

Glovoapp23

ALSO

Toyo Tire Corporation

Mizuho Bank

Europrojekt Duo

MRI Trading

Centogene

Yazaki Europe

Suez Groupe

I-Environment Investments

Beo Čista Energija

HTEC

Naftna industrija Srbije

Cineplex

Lexmark International Technology

Work highlights
  • Successfully assisted Glovoapp23 с приобретением за 170 млн евро операций Delivery Hero в Румынии, Хорватии, Сербии, Болгарии, Черногории и Боснии и Герцеговине.
  • Консультирование швейцарской группы ICT ТАКЖЕ в связи с приобретением сербского ИТ-провайдера, работающего в Сербии, Черногории и Боснии и Герцеговине.
  • Консультирование японской компании Toyo Tire Corporation в связи с ее инвестициями в Сербию, включая строительство и эксплуатацию завода по производству шин в Республике Сербия.

Prica & Partners

Независимая коммерческая юридическая фирма Prica & Partners предоставляет полный спектр услуг во всех областях коммерческого права. Команда постоянно консультирует сербские и международные компании по корпоративным и коммерческим сделкам, слияниям и поглощениям, регистрации и составлению контрактов, а также по корпоративному управлению, вопросам акционеров и реструктуризациям. Соруководителями группы являются Даница Глигориевич, специалист по слияниям и поглощениям, корпоративному праву, энергетике, инфраструктуре и налоговым вопросам, и Ана Чалич Турудия, имеющая многолетний опыт консультирования по крупным сделкам слияний и поглощений. Также неотъемлемой частью практики является управляющий партнер и эксперт по корпоративному праву, слияниям и поглощениям и коммерческому праву Михайло Прица.

Руководитель практики:

Даница Глигориевич; Ана Чалич Турудия

Другие ключевые юристы:

Михайло Прица; Велько Нешич; Ана Крстич

Отзывы

Я всегда впечатлен их профессионализмом, ориентированным на решения отношением и навыками межличностного общения.

Я считаю их всех прекрасными коллегами.

Услуги этой юридической фирмы очень профессиональны.

Команда очень профессиональна и инициативна.

Отличная работа с клиентами, быстрота реакции и качество документов.

Высокая конкурентоспособность в международной среде.

Ключевые клиенты

Innova Capital

The Rohatyn Group

Astrazeneca

Acibadem

Airbnb

Wizz Air Hangary

Bain Capital

Corta

.0004

DM Drogerie Markt

Borealis

Американские советы

Правительство Республики Сербия

IGT-Europe

Sandoz

ENEREQ ENERGY

H & Menses & Mauritz

ENEL

.

Panasonic

Sanofi

Grundfos

Shell

HBO

Cisco

Boehringer

Vroom

3 Abbvie0004

Syngenta

Mercator

Основные моменты работы
  • Совместно с другой сербской юридической фирмой и в сотрудничестве с Lazard в качестве финансового консультанта консультировал правительство Республики Сербия по продаже контрольного пакета акций Komercijalna banka компании Nova Ljubljanska Banka.
  • Консультирование турецкой медицинской группы Acibadem по сербским аспектам трансграничного проекта, в рамках которого она приобрела 70% акций сербской частной медицинской компании Bel Medic.
  • Помощь (в сотрудничестве с международной юридической фирмой) Rohatyn Group (частный спонсор хедж-фонда) в продаже Pet Network International.

Юридическая фирма SOG

Юридическая фирма SOG консультирует по широкому кругу вопросов корпоративного права в Юго-Восточной Европе и может использовать свое членство в Lexcellence, альянсе независимых юридических фирм, работающих в ЮВЕ. Милан Самарджич помогает международным и местным клиентам с крупномасштабными сделками по слияниям и поглощениям и совместными предприятиями, а его недавняя рабочая нагрузка включает крупные инвестиционные проекты как в Сербии, так и в более широком регионе. Опытный старший юрист Милан Новаков в основном занимается вопросами корпоративного права и слияний и поглощений, банковского дела и финансов, а также конкурентного права.

Руководитель(и) практики:

Милан Самарджич

Другие ведущие юристы:

Милош Велимирович; Милан Новаков

Отзывы

«Фирма имеет уникальную команду опытных юрисконсультов, обладающих знаниями во всех соответствующих областях корпоративного бизнеса.

Они очень эффективны и понимают деловую и макроэкономическую ситуацию, а также потребности своих клиентов.

Команда опытных, хорошо подготовленных и надежных юристов.

‘Это небольшая практика, но это означает, что юристы более ориентированы на клиента и готовы тратить время на поиск оптимальных юридических решений.

Фирмой руководят очень опытные партнеры, которые вселяют уверенность в том, что работа будет выполнена на высоком уровне. Очень хорошая коммуникация и гибкость оплаты также заслуживают упоминания.

Милан Самарджич – отличный коммуникатор, чей коммерческий взгляд столь же ценен, как и его юридические знания.

Милош Велимирович предан своему делу, понимает потребности клиентов и эффективно решает корпоративные вопросы.

С Миланом Новаковым приятно работать, и он очень компетентен.

Ключевые клиенты

Tesla

Strabag

Delta Holding

Lafarge

Центр солидарности

Bekament

Alfi Funds

9000lin0004

Air France KLM

McCann

DB Schenker

FCC Group

Abbott Laboratories

Vice Media

Outsource Insurance Professionals

Dubai National Air Transport Association

Meinl Bank

Softline Eastern Europe & Central Asia

TransPerfect Translations

NBGP Properties

AiCure

Roaming Electronics

Fincredible

PSI CRO

Основные моменты работы
  • Консультирование сингапурской компании Namara Wealth Advisors в связи с приобретением Universal Capital Bank в Черногории.
  • Консультирование H-Planet по вопросам приобретения части компании, занимающейся строительством ветряной электростанции Кривача.
  • Консультирование KF-Finance, региональной консалтинговой и инвестиционной группы, в связи с приобретением сербской компании Frezal, которая специализируется на разработке и производстве пресс-форм.

Doklestic Repic & Gajin

Группа корпоративного права и слияний и поглощений коммерческой юридической фирмы Doklestic Repic & Gajin регулярно привлекает международные юридические фирмы, корпорации, инвестиционные фонды и банки в качестве ведущего регионального юрисконсульта по многоюрисдикционным проектам в Адриатический регион. Департамент возглавляет Слободан Доклестич, чья практика охватывает корпоративное право, слияния и поглощения, частный капитал, реструктуризацию и изменение корпоративного статуса;   Милош Панджич ‘ дает краткие, ясные и логичные советы ’; и Александра Стоянович – опытный управляющий партнер.

Руководитель(и) практики:

Слободан Доклестич

Другие ключевые юристы:

Милош Панджич; Александра Стоянович; Любинка Плевальчич; Dragan Gajin

Testimonials

Лучшего юриста и желать нельзя — вся команда DRG просто фантастическая.

Для клиентов, для которых очень важна эффективность, эта фирма – идеальный выбор.

Они учитывают (и полностью понимают) потребности клиентов.

Профессионально, надежно и быстро.

Практика коммерческого, корпоративного права и слияний и поглощений отличается уникальным подходом к решению проблем, завидным использованием технологий и гибкими вариантами выставления счетов.

Слободан Доклестич и Милош Панджич предлагают исключительный сервис и широкий спектр решений.

Милош Панджич дает краткие, четкие и логичные советы. Он попадает в точку, гибок и ориентирован на клиента, и реагирует очень быстро.

Александра Стоянович обладает очень предпринимательским подходом и мышлением, а также глубоким знанием корпоративного права, что очень важно для нас.

Ключевые клиенты

Philip Morris

Beijing New Building Materials

Galenika

AmRest

BalkanTel

Karcher

Pharmachim

WSP UK

Tarkett

Ingenico Group

Radisson Collection Hotel Belgrade

UnifiedPost Group

SN Apollo

China Huadian Hong Kong Company

Carlsberg

Saint-Gobain

VisionFund International

Posh & Media

АИК Банк

Balkan Gold

DTD Group

G4S Secure Solutions

Основные моменты работы
  • Консультирование фонда прямых инвестиций (через международную юридическую фирму) в связи с приобретением сербского филиала региональной ИТ-компании.
  • Консультирование компании Beijing New Building Materials в связи с ее инвестицией в размере 60 млн долларов США в совместное предприятие, включающее шахту и тепловую электростанцию.
  • Консультирование PRONATAL Group по вопросам создания и лицензирования специальной больницы для оказания медицинских услуг ЭКО.

Марич, Малишич и Достанич о.а.д.

Maric, Mališic & Dostanic o.a.d. Корпоративную, коммерческую практику и практику слияний и поглощений компании Maric, Mališic & Dostanic возглавляет управляющий партнер Ана Марич, обладающая более чем 15-летним опытом консультирования по вопросам слияний и поглощений и транзакций как в Сербии, так и в более широком балканском регионе; Растко Малишич, обладающий значительным опытом в области информационных технологий, фармацевтики, банковского дела и страхования; и специалист по слияниям и поглощениям, корпоративному и коммерческому праву Оливер Радосавлевич, который особенно активно работает в сфере товаров народного потребления и энергетики.

Руководитель(и) практики:

Ана Марич; Оливер Радосавлевич; Растко Малишич

Другие ключевые юристы:

Урос Жигич; Miodrag Klancnik

Testimonials

Юридическая контора с очень практической ориентацией, которая имеет для нас большое значение.

Их юридические заключения и отзывы всегда своевременны, точны и ориентированы на бизнес.

‘У них активный подход, который очень ценится – например, когда вступают в силу новые правила, они обращаются к нам с ожидаемыми решениями.

Оливер Радосавлевич и Миодраг Кланчник обладают большим опытом и знаниями в коммерческих и корпоративных вопросах. Полученная от них обратная связь всегда четкая и актуальная, юридические заключения хорошо структурированы и содержат альтернативные решения для каждого запроса (по возможности).

Ключевые клиенты

RTE international

Crédit Agricole

Unilever

Suez

Decathlon

Goodyear

Orbis

Accor Hotels Group

Robert Bosch

IKEA

French Embassy In Belgrade

Havas Group

Acolin Infotech

Mg Precast

Fela Planungs

SK-Pharma

Letač Construction

Aleamani Trade

Puratos

Blitz Group

Safic Alcan

Mitsides Point

Контроль закупок

Icargo

Learnupon

Основные моменты работы
  • Консультирование Crédit Agricole в связи с продажей его дочерних компаний Crédit Agricole Srbija и CA Leasing в Сербии группе Raiffeisen.
  • Консультирование Agence Française de Développement по кредитной сделке на сумму 51 млн евро с Республикой Сербия для проекта модернизации государственного железнодорожного транспорта.
  • Консультирование ИКАРГО по продаже доли в дочерней компании по производству фруктов.

MVJ markovic vukotic jovković

Команда MVJ markovic vukotic jovković хорошо известна своими консультациями для клиентов в сфере розничной торговли, сельского хозяйства и производства строительных материалов. Практика также заняла нишу в оказании помощи состоятельным лицам в корпоративных, финансовых и налоговых структурах. Опыт Марко Йовковича охватывает сделки по слияниям и поглощениям, реструктуризации и трансграничного финансирования, а опыт Душана Джорджевича включает структурирование сложных реорганизаций и проектов в Сербии, Черногории и Боснии и Герцеговине.

Руководитель(и) практики:

Марко Йовкович

Другие ведущие юристы:

Душан Джорджевич; Елена Оташевич; Бояна Рачанович

Отзывы

MVJ способна быстро адаптироваться и работать в режиме многозадачности в критические моменты.

Они прилагают максимум усилий, чтобы выполнить свой мандат.

Их уникальное знание рынка делает их уникальными.

Они всегда предлагают эффективное решение.

MVJ выполняет важную вспомогательную функцию для наших деловых операций, хорошо понимая потребности нашего бизнеса.

Гибкий и быстрый подход к решению проблем делает MVJ нашим лучшим выбором для всех сделок M&A, что позволяет нам эффективно выполнять все операционные и стратегические требования.

Марко Йовкович и Бояна Рачанович – выдающиеся юристы, и их подход всегда разумен. Они всегда четко и кратко объясняют нам то, что мы хотим знать, понимают нашу отрасль и предсказывают юридические и коммерческие ловушки.

Вдумчивые и глубокие юридические навыки Душана Джорджевича сочетаются с солидными отраслевыми знаниями.

Ключевые клиенты

IKEA

Valastone

Большие торговые центры Israel

Big Cee Srbija

VGP Group

NEPI Rockcastle

Victorioil

964 HENTERSIRIELENSIRILISIOR

SIRIELIRINE

HENTERSIRIELSIOR

SRITION

SRITION

HENTERSIRIELSIORIORIOL AINTIRILENS

.

Оптимальное управление проектами

Микроконтроль

Accor Hotels

Mides Healthcare Technology

CBRE

Erber Biotech

Moravacem

Victoria Group

Danakali

Agrostadt

Aura

. Agrostad

Aura

. сояпротеина к ADM.
  • Консультирование Xella в связи с приобретением Rapid AD посредством предложения о поглощении.
  • Консультирование Victoria Group в связи с продажей VictoriaOil компаниям Oaktree Capital Management и Transoil.
  • NKO Partners

    Практика NKO Partners особенно опытна в консультировании клиентов из секторов недвижимости, добычи полезных ископаемых, товаров народного потребления и розничной торговли, и команда все больше занимается вопросами, связанными с фармацевтикой и ИТ. Типичная работа включает структурирование и ведение переговоров по проектам слияний и поглощений и нормативным вопросам, а также коммерческие сделки с ключевыми поставщиками, дистрибьюторами и поставщиками услуг клиентов. Соруководителями корпоративного отдела являются Джордже Николич и Джуро Отасевич, которым 9 лет.0293 очень коммерчески подкованный ’.

    Руководитель(и) практики:

    Джордже Николич; Джуро Отасевич

    Другие ключевые юристы:

    Дамьян Деспотович; Марина Николич; Milica Boskov

    Testimonials

    «Они обладают глубокими юридическими знаниями, но в то же время хорошо разбираются в коммерции.

    Хорошее соотношение цены и качества, очень быстрый и отзывчивый.

    Команда доказала свою преданность нам и помогла нам разработать креативные решения для коммерческих контрактов, которые важны с разных точек зрения.

    Мы довольны тем, как им удалось вникнуть в тонкости нашего нишевого пространства, чтобы помочь нам достичь результатов с нашими партнерами и коллегами.

    Солидный, всегда надежный и всегда на высоте.

    Джордже Николич и Джуро Отасевич отлично. Оба демонстрируют глубокие знания в своей области, но в то же время очень коммерчески подкованы и ценят деловые аспекты сделок, над которыми они работают.

    «Джуро Отасевич — выдающийся юрист, который помогал нам в различных вопросах, что свидетельствует о широте его опыта.

    Джуро Отасевич выделяется как партнер, обеспечивающий такое же качество (и с той же скоростью), что и партнеры ведущих фирм, при гораздо меньших затратах.

    Ключевые клиенты

    General Electric

    PepsiCo

    First Quantum

    Dr Max

    Konica Minolta

    CTP

    Heineken

    Tendam Group

    Metro Cash & Carry

    Chemonics

    Azelis

    Stankovic & Partners (NSTLAW)

    Член Global Referral Network Nextlaw & Partners, Stankovic Netlink и Legal Netlink) регулярно помогает в трансграничных корпоративных сделках и сделках по слияниям и поглощениям с участием корпораций и банков. Практика также консультирует по внутренним корпоративным вопросам, а также по общей коммерческой работе. Практику возглавляет известный партнер и специалист по международному бизнес-праву Ненад Станкович. Практика старшего юриста Сары Пенджер охватывает вопросы корпоративного права, слияний и поглощений, приватизации и энергетики.

    Руководитель(и) практики:

    Ненад Станкович

    Другие ведущие юристы:

    Сара Пенджер

    Отзывы

    «> ‘ Исключительный профессионализм и подготовка и оперативные ответы.

    Ключевые клиенты

    Banjalucka pivara

    Sherwin-Williams

    British American Tobacco

    Sitel DOEL

    Titantex SRL Unipersonale

    Teddy

    Edelweiss Balance

    Beauvallon Europe

    INsig2

    Aelius SARL Luxembourg

    Apatinska pivara

    Monster Energy

    Work highlights
    • Advising Apatinska пивара (часть Molson Coors) по ряду корпоративных и коммерческих вопросов.
    • Консультирование MacGregor Norway (в качестве местного юрисконсульта) по вопросам внедрения изменений в отношении структуры управления ее дочерней компании в Сербии.
    • Консультирование швейцарской компании Edelweiss Balance в связи с приобретением акций сербской компании AB Energo, специализирующейся на торговле электроэнергией, у голландской компании Edelveys Holding.

    Юридическое бюро Живкович и Самарджич

    Юридическое бюро Живкович и Самарджич Отдел корпоративного права и слияний и поглощений постоянно занимается сложными бизнес-транзакциями, а также предоставляет стратегические корпоративные консультации национальным и международным коммерческим, финансовым и промышленным предприятиям в Сербии. Группу совместно возглавляют эксперт по трансграничным сделкам Бранислав Живкович, который координирует международное сотрудничество фирмы в рамках LGP Legal Solutions Network; Эксперт по сделкам ТМТ Небойша Самарджич; и Игорь Живковский, 9 лет0293 отличный юрист с блестящими идеями ’.

    Руководитель(и) практики:

    Бранислав Живкович; Небойша Самарджич; Игорь Живковски

    Другие ключевые юристы:

    Сава Павлович

    Отзывы

    Команда очень практична и понимает, как сделать все быстро и легко, не жертвуя рисками.

    Преданные своему делу, знающие и опытные специалисты, которые дают очень прямые и полезные советы, что очень ценится.

    Мы ценим их глубокое знание местного рынка и широту опыта.

    Эта команда имеет очень сильную коммерческую, корпоративную практику и практику слияний и поглощений, которая демонстрирует глубокие знания корпоративного права Сербии.

    Эта практика является выдающейся, полностью занятой и доступной 24/7.

    Вся команда замечательная, но особенно Игорь Живковский, отличный юрист с блестящими идеями.

    ‘Игорь Живковски был великолепен. Он направил нас к самым простым и эффективным вариантам сделки — и отлично справился с управлением процессом. Игорь привносит много знаний о местных условиях и опыт транзакций и использует этот опыт для быстрого выполнения задач.

    Ключевые клиенты

    Kopernikus Corporation

    Nestlé Adriatic

    Titan Cementara Kosjeric

    Prva Televizija

    B92

    Astonko

    Petrol D D Ljubljana

    Firefly Productions

    Helbiz Serbia

    Credo Ventures

    The Joberty Technologies

    Direktna Banka

    EUROBANK

    . Hights
    903NA 903NA 903NA 903NA 903NA 903NA 903NA 903NA 903NA 903NA 903NA 903NA 903NA 903NA 903NA 903NA 903NA 903NA 903NA 903NA 903NA 903NA 903NA 903NA 903NA 903NA.
  • Консультирование Credo Ventures по вопросам приобретения Trickest Hive.
  • Консультирование Joberty Technologies по вопросам присоединения нового акционера и последующего увеличения уставного капитала.
  • Юридическая фирма Атанасковича — Божовича

    Сектора, в которых юридическая фирма Атанаскович — Божович особенно активна, – энергетика, фармацевтика, здравоохранение и строительство. Урош Атанаскович имеет опыт в области слияний и поглощений и корпоративных вопросов, а его коллега Вук Божович является специалистом по проектам в области строительства, недвижимости и энергетики. Присяжный поверенный Марко Мрвич помогает в вопросах сделки.

    Руководитель(и) практики:

    Урош Атанаскович

    Другие ключевые юристы:

    Вук Божович; Марко Мрвич

    Отзывы

    Я работаю с этой юридической фирмой более десяти лет с полной уверенностью, что о моем бизнесе позаботятся.

    Они быстро реагируют и хорошо разбираются в корпоративном праве, налогообложении, инвестициях и государственных фондах.

    Ключевые клиенты

    Дунавпласт Корп

    ВетСмарт

    Ла Каннтина

    Softech Solutions

    BGD Fresh Solutions

    Fruit Invest

    Огромные средства массовой информации

    Французская торговая палата и промышленность в Сербии

    Интегрированная микроэлектроника

    Euroty

    Webtiste

    4444004

    44447 Осуществляя сопровождение слияний и поглощений, Адвокатское бюро Baklaja Igric Tintor регулярно оказывает помощь начинающим компаниям, в первую очередь в отношении финтех- и ИТ-проектов.

    Фирма также имеет отраслевой опыт в области телекоммуникаций, фармацевтики, продуктов питания и напитков, туризма и отелей, а также розничной торговли. Джордже Игрич имеет опыт в области слияний и поглощений, корпоративных вопросов, приватизации и реструктуризации.

    Руководитель(и) практики:

    Джордже Игрич

    Другие ключевые юристы:

    Марко Белич

    Отзывы

    ‘902. ‘

    Они предоставляют клиентам решения и помогают выбрать правильное.

    Целеустремленный, точный и профессиональный.

    Отличная поддержка в любых сложных ситуациях – фирма является ключевым ресурсом для нашей компании.

    ‘Прозрачный и активный подход, который помог нам во многих ситуациях.

    Как команда, они представляют собой отличный пакет с различными техническими навыками.

    Команда была очень профессиональной и преданной делу, демонстрируя структурированный подход и выдающиеся способности решения проблем.

    Джордже Игрич является ценным партнером, когда речь идет о наших отношениях с инвесторами.

    Ключевые клиенты

    Advans Group

    Deloitte

    City Expert

    Instant Factoring

    International Food Factory

    Fush

    Mobi Gas

    JUNYUE

    LDS

    Omen Media

    Carers HQ

    Elsys Group

    Skill Up

    RadioTalk

    Sobot

    Resolve

    Основные моменты работы
    • Консультирование Advans Group как по процессам приобретения, так и по вступлению в совместные предприятия в отношении стартап-проектов в области ИТ.
    • Оказывал помощь Deloitte (в качестве главного консультанта по сделке) в приобретении телекоммуникационного сектора.
    • Помощь акционерам онлайн-агентства недвижимости «Сити Эксперт» в рассмотрении стороннего инвестиционного предложения.

    Юридическая фирма Михая, Илича и Милановича

    Юридическая фирма Михая, Илича и Милановича объединяет специализированные команды в области корпоративного и коммерческого права и финансов. Практика имеет особый опыт в области здравоохранения, фармацевтики, энергетики, инфраструктуры, производства и авиации. Марко Миланович — специалист по коммерческому и корпоративному праву, а Таня Унгуран — опытный эксперт по слияниям и поглощениям, корпоративному и налоговому праву.

    Руководитель практики:

    Марко Миланович; Таня Унгуран

    Другие ключевые юристы:

    Боян Янкович; Елена Папич

    Отзывы

    «Они хорошо знакомы с авиационным правом, что для нас очень важно. Их платежная система уникальна для этого региона».

    «Марко Миланович — очень хорошо организованный и энергичный юрист. Елена Папич — юрист-энтузиаст, который готов уделять внимание деталям и следить за тем, чтобы все было сделано в соответствии с договоренностью».

    «Команда чрезвычайно предана каждому вопросу, и мы ценим их подход. Они чрезвычайно отзывчивы, даже в очень сжатые сроки, демонстрируя при этом отличное управление юридическими вопросами. Юристы очень квалифицированы и готовы предоставить вам профессиональную помощь в любое время».

    «Елена Папич — очень преданный своему делу молодой юрист, способный найти разумные решения для самых деликатных вопросов. Таня Унгуран консультирует нас по корпоративным и налоговым вопросам, и я бы охарактеризовал ее как очень энергичного и уважаемого юриста в Сербии. Боян Янкович консультирует по трудовым вопросам и является очень прагматичным участником судебных процессов. Марко Миланович чрезвычайно активен — он обладает большим опытом и обладает очень здравым смыслом».

    «Моя компания работает с MIM уже много лет. У меня отличное мнение о нашем сотрудничестве, и мы планируем его продолжить. Самым большим плюсом в моем списке является их опыт и доступность в любое время дня и ночи, что необходимо в динамичной среде фармацевтической промышленности». человек – опытный, доступный, готовый выслушать и оказать любую юридическую поддержку в случае необходимости»

    «MIM — это фирма, которую можно использовать в трудной ситуации. Я знаю, что когда я позвоню им, я получу наилучшее возможное решение».

    «Я знаю Марко Милановича на протяжении десятилетий и пользуюсь его услугами в особых ситуациях, когда у меня нет ответа. Он всегда очень спокоен, сосредоточен и способен найти лучший вариант».

    Ключевые клиенты

    Vulcascot

    Doka Serb

    Galeb Group

    Zimpa Ub

    Oil Processing Company Europe

    Alcon Pharmaceuticals

    Global Seed

    Duo Bacco

    Основные моменты работы
    • Оказание корпоративной и коммерческой поддержки сербскому авиаперевозчику Air Serbia.
    • Предоставление полной корпоративной и коммерческой поддержки иностранным акционерам в отношении регулирования отношений с мажоритарными акционерами сербской компании.
    • Предоставление консультационных услуг и корпоративной поддержки всему холдингу Galeb Group.

    Subotic & Jevtic — Attorneys at Law

    Основанная в 2017 году, Subotic & Jevtic — Attorneys at Law консультирует международных клиентов по корпоративному и коммерческому праву, а также по вопросам конкуренции и защиты данных. Юлиана Евтич имеет многолетний опыт в области слияний и поглощений, приватизации, реструктуризации и банкротства, а Милица Суботич имеет обширную практику, включающую корпоративное право, слияния и поглощения и финансы.

    Головка(и) практики:

    Юлиана Евтич

    Другие ключевые юристы:

    Милица Суботич

    Отзывы

    Удовлетворяет нашим высоким ожиданиям в отношении качества услуг, но без больших фиксированных расходов и административных ограничений, которые являются конечными фирмы.

    Предоставляет разумные, продуманные советы с помощью всего лишь телефонного звонка или электронной почты.

    Вселяет в нас большую уверенность в наших усилиях.

    Они отличные юристы, с ними легко работать – я очень рекомендую их.

    Команда очень компетентна и имеет большой опыт.

    Юлиана Евтич понимает реальные потребности и ограничения клиентов.

    Милица Суботич профессиональна, эффективна и всегда по делу.

    Милица Суботич – красноречивый и убедительный человек, который всегда готов удовлетворить особые потребности клиентов.

    Key clients

    Lukoil a d Belgrade

    Agri Business Partner

    Mtel a d Banja Luka

    Antagon

    Banadale

    Meractor-S

    Novo Nordisk Pharma

    Wienerberger

    Work highlights
    • Advised Agri Деловой партнер в предложении о поглощении миноритарных акций целевой компании PP Miletic.
    • Консультирование PP Miletic по вопросам приобретения доли собственности.

    Вукович и партнеры

    Имея значительный опыт работы в сфере коммерческой деятельности, корпоративного права и слияний и поглощений, Vukovic & Partners консультирует сербских и международных клиентов в различных секторах, в частности, в судоходстве и логистике, энергетике и природных ресурсах, а также в сфере недвижимости и строительства. Команду возглавляют управляющий партнер Деян Вукович и Деян Пламенак, который недавно стал партнером.

    Руководитель(и) практики:

    Деян Вукович; Деян Пламенак

    Отзывы

    A v профессиональная команда, знающая обо всех изменениях в законодательстве.

    Команда постоянно следит за изменениями в бизнесе своих клиентов.

    Они всегда гибки в плане оплаты и всегда идут навстречу моим потребностям.

    Всегда точно и точно. Они подробно объясняют рекомендации.

    Я очень доволен Vukovic & Partners.

    Отличные коммуникативные навыки и заботливая практика.

    Быстрые и очень прагматичные – они понимают проблемы клиента и дают отличные советы.

    Деян Пламенак обеспечивает отличную поддержку и очень отзывчив.

    Ключевые клиенты

    P&O Ports FZE

    Nyholmen Invest

    MSG Global Solutions

    Агентство США по международному развитию

    Dry Docks World

    Jugo-Kaolin

    Глобальные преимущества Европа

    Worleyparsons Energy Services

    Kopa Investment Corporation

    Niksen Investment

    Enna Fruit

    MINALERCY

    KOSTAG

    .

    Integral Group International

    Eurobau Connect AG

    Glob Metropoliten

    Project Consultum SRB

    Two dots doo

    Goldair Handling

    Основные моменты работы
    • Консультирование P&O Ports FZE по вопросам коммерческого предприятия и инвестиций в порт Нови-Сад.
    • Консультирование Nyholmen Invest по местным аспектам продажи Rapp Zastava, сербской компании, поставляющей лебедки и другие решения для морской отрасли.
    • Консультирование Two Dots doo Belgrade по приобретению портфелей проблемных кредитов.

    Адвокатское бюро «Зависин Семиз»

    Адвокатское бюро «Зависин Семиз», известное своей работой в сфере слияний и поглощений, корпоративным и коммерческим правом, предлагает широкий спектр услуг: от консультирования по вопросам стартапов, стратегического расширения, структурирования бизнеса и соблюдения нормативных требований до управления стратегиями выхода из бизнеса. Команда, возглавляемая Наташей Завишиной и Стояном Семизом, также имеет опыт корпоративного структурирования крупных сделок с недвижимостью.

    Руководитель практики:

    Наташа Завишин; Стоян Семиз

    Другие ключевые юристы:

    Никола Шугарис

    Отзывы

    Очень коммерческая фирма, которая активно следит за событиями в Сербии и регионе.

    ‘Фирма имеет высококвалифицированную команду юристов, которые сосредоточены на международных сделках и понимают, что требуют и ценят международные клиенты.

    Они очень хорошо осведомлены, практичны, отзывчивы и с ними легко сотрудничать.

    Очень сильная команда со старшими опытными юристами, которые выполняют реальную работу, а не наблюдают за работой молодых коллег.

    Наташа Завишин и Стоян Семиз являются лучшими профессионалами в своих областях знаний. При этом они всегда внешне спокойны, но видно, что у них постоянно крутятся колеса в головах и они всегда думают на несколько шагов вперед, для того, чтобы сделка дошла до успешного завершения.

    Языковые навыки Наташи Завишин и Стояна Семиза в совершенстве. Они отзывчивы и очень хорошо разбираются в различных отраслях и бизнес-культурах.

    Стоян Семиз был очень полезен как в консультировании по вопросам сербского законодательства, так и в представлении по запросу. Он очень хорошо разбирается в рынке и отличный юрист.

    Доступность Николы Шугариса не ограничивается обычным рабочим временем, но адаптирована к потребностям нашей компании – он очень готов к сотрудничеству и быстро находит решения.

    Key clients

    GTC

    Belgrade Waterfront

    Eagle Hills Properties

    Mid Europa Partners

    MediGroup

    Durst Development Beograd

    Mivne Group

    Global Finance

    Motherson Group

    Work highlights
    • Консультирование GTC в связи с продажей пакета из 11 офисных зданий в пяти бизнес-парках (путем сделки с акциями на сумму 267,6 млн евро).
    • Консультирование Mid Europa Partners по вопросам корпоративной консолидации MediGroup, ее бизнеса в сфере здравоохранения в Сербии.
    • Консультирование Belgrade Waterfront по открытию Galerija Belgrade, крупнейшего торгового центра в регионе.

    Вычислительная статистика и нейробиология: 2011

    Дэвид Пфау: 20 декабря.

    Дэвид проведет краткий обзор ряда интересных статей из NIPS.

    Во-первых, это «Эмпирические модели спайков в нейронных популяциях» Маке, Бюсинга, Каннингема, Ю, Шеноя и Махани, где они оценивают относительные достоинства GL-моделей с парной связью и моделями пространства состояний при многоэлектродной записи в моторной коре.

    Далее, Квазиньютоновские методы Монте-Карло для цепей Маркова Чжан и Саттон рассматривают, как использовать приближенные методы второго порядка, такие как L-BFGS, для MCMC, сохраняя при этом подробный баланс.

    Затем раздельный анализ основных компонентов является расширением PCA, которое разделяет зависимость различных скрытых измерений от различных наблюдаемых параметров и используется для анализа нейронных данных из PFC

    Наконец, обучение обучению с помощью сложных иерархически-глубоких моделей, объединяет глубокую нейронную сеть для изучения визуальных характеристик с иерархической непараметрической байесовской моделью для изучения категорий объектов, чтобы сделать одну классную демонстрацию.

    Предыдущие собрания группы (для архивных целей)

    Универсальная оценка MAP в сжатом зондировании, Барон и Дуарте

    Количественная статистическая взаимозависимость путем передачи сообщений на графиках, Даувелс, Виалатт, Вебер и Чихоки. Часть I и Часть II

    Пробоотборник No-U_Turn: адаптивная установка длины пути в гамильтониане Монте-Карло, Хоффман и Гельман.

    Ари Пакман: ​​13 декабря.

    «Изменение масштаба, прореживание или дополнение? О процедурах согласия для точечных моделей процессов и обобщенных линейных моделей» Герхарда и Герстнера (NIPS 2010).

    Ссылка: http://books.nips.cc/papers/files/nips23/NIPS2010_0767.pdf

    Аннотация гласит:

    «Обобщенные линейные модели (GLM) становятся все более популярной основой для моделирования нейронных спайков. Они были связаны с теорией стохастических точечных процессов, и исследователи использовали это отношение для оценки согласия с использованием методов теории точечных процессов, например, теоремы о масштабировании времени. разбивка предположений, необходимых для этой связи.Здесь мы показываем, как тесты согласия из теории точечных процессов все еще могут быть применены к GLM путем построения эквивалентных суррогатных точечных процессов из наблюдений временных рядов.Кроме того, два дополнительных теста вводятся основанные на прореживании и дополнении точечные процессы. Они дополняют инструменты, доступные для проверки адекватности моделей точечных процессов, а также дискретных моделей ».

    Коля Садеги : 20 сентября.

    На этой неделе я дам краткий обзор ряда недавних статей о точном восстановлении разреженных сигналов, которые работают лучше, чем LASSO, путем решения последовательности штрафных задач L1 или L2. Вот основное описание:

    LASSO использует штраф, взвешенный на одну и ту же лямбду для всех коэффициентов. Что произойдет, если вы назначите разные лямбда-выражения каждому коэффициенту и итеративно обновите эти лямбда-выражения? Кандес и Бойд делают это в Повышении разреженности за счет повторного взвешивания L1-минимизации 9. 0004

    Вы можете получить разреженность с помощью итеративного повторного взвешивания даже для задач со штрафом L2: если некоторые из лямбд становятся бесконечными, соответствующие коэффициенты становятся точно нулевыми. Чартран и Инь находят особенно хорошую схему повторного взвешивания L2 в алгоритмах повторного взвешивания с итеративным взвешиванием для измерения сжатия

    . Все вышеперечисленные методы повторно взвешивают каждую лямбду только на основе значения соответствующего коэффициента: они являются разделимыми. В итеративных методах l1 и l2 с повторным взвешиванием для поиска разреженных решений Wipf рассматривает схемы неразделимого повторного взвешивания, которые выходят из разреженного байесовского обучения (SBL), которые вы также можете знать под названием машина вектора релевантности или автоматическое определение релевантности.

    Алекс Рамирес: 6 июля

    Алекс продолжит презентацию недавней статьи Agarwal et al. (см предыдущий пост)

    Алекс Рамирес: 21 июня

    Алекс представит краткую версию этой статьи. В нем авторы рассматривают функции потерь для многих оценок, которые подчиняются определенным требованиям гладкости и выпуклости, и доказывают глобальную геометрическую (быструю) скорость сходимости по методу градиентного спуска Несторва до уровня статистической точности.

    14 июня встречи не будет.

    Камиар Рахнама Рад: 7 июня

    Скорость передачи информации и оптимальное декодирование в больших популяциях

    Многие фундаментальные вопросы теоретической нейронауки связаны с оптимальным декодированием и вычислением скорости передачи информации Шеннона в популяциях спайковых нейронов. В этой статье мы применяем методы асимптотической теории статистического вывода, чтобы получить более четкое аналитическое понимание этих величин. Мы обнаружили, что для больших популяций нейронов, несущих конечный общий объем информации, полный отклик популяции на спайки асимптотически так же информативен, как одно наблюдение из гауссовского процесса, среднее значение и ковариация которого могут быть явно охарактеризованы с точки зрения свойств сети и отдельного нейрона. Гауссова форма этой асимптотической достаточной статистики позволяет нам в некоторых случаях выполнять оптимальное байесовское декодирование с помощью простых линейных преобразований и получать выражения в замкнутой форме для шенноновской информации, переносимой сетью. Одним из технических преимуществ теории является то, что ее можно легко применить даже к сетевым моделям точечных процессов без Пуассона; например, мы обнаружили, что при некоторых условиях нейронные популяции с сильными зависящими от истории (не пуассоновскими) эффектами несут точно такую ​​же информацию, как и более простые эквивалентные популяции невзаимодействующих пуассоновских нейронов с согласованной частотой срабатывания. Мы утверждаем, что наши результаты помогают прояснить некоторые результаты недавней литературы по нейронному декодированию и дизайну нейропротезов.

    Эрик Ши-Браун: 31 мая.

    Эрик Ши-Браун, проделавший весь этот путь из Университета Вашингтона, будет говорить о:

    Механическом подходе к многоспайковым паттернам в нейронных цепях:
    Существует комбинаторный взрыв в количестве возможных паттернов активности в нейронных цепях увеличивающегося размера, что обеспечивает огромную сложность, в которой возникают паттерны и как они зависят от поступающих стимулов. Однако недавние эксперименты показывают, что эта сложность не всегда доступна — активность многих нейронных популяций удивительно хорошо описывается более простыми описаниями, основанными только на активности отдельных нейронов и пар нейронов.

    Что особенно интригует, так это то, что эти попарные описания успешны даже в тех случаях, когда архитектура схемы создает гораздо более сложный набор выходных данных. Мы ищем механистическое понимание этого явления — и прогнозы того, когда оно выйдет из строя — на основе простых моделей генерации спайков, связности цепей и стимулов. Это также дает возможность изучить, насколько (и насколько мало) непарные паттерны спайков могут иметь значение для кодирования в разных схемах.

    В качестве конкретного приложения мы рассматриваем эмпирический успех парных моделей в захвате активности ганглиозных клеток ON-parasol сетчатки. Сначала мы используем внутриклеточные записи, чтобы полностью ограничить модель базовой динамики цепи. Затем наша теория дает объяснение экспериментальным данным, основанным на свойствах фильтрации стимулов ON-зонтика и генерации спайков.

    Это совместная работа с Андреа Баррейро, Джулианой Джорджиевой и Фредом Рике.

    Макс Никитченко: 10 мая

    В этот вторник, 10 мая 2011 г., я буду обсуждать методы ускорения сходимости алгоритмов с линейной сходимостью вблизи фиксированной точки, таких как EM, которые, как известно, очень медленны в этой области. Возможны два подхода: модифицировать сам итерационный алгоритм (PX-EM (путем расширения параметров), ECM (путем максимизации максимизатора отдельно для каждого параметра, сохраняя фиксированными остальные) и т. д.) или использовать недавнюю историю итераций для экстраполируйте их ближе к фиксированной точке (в этом случае вы сохраняете весь свой механизм нетронутым и подключаете только вспомогательную функцию для экстраполяции уже вычисленных шагов итерации). Я буду говорить о втором классе ускорителей.

    Я начну с метода, который я разработал сам, который является наглядным, но в то же время мощным. Затем я сосредоточусь на двух статьях, которые, кажется, стали золотым стандартом в методах ускорения: Варадхан, Р. и Роланд, К. «Простые и глобально конвергентные методы ускорения сходимости любого алгоритма ЭМ» (dx.doi.org/ 10.1111/j.1467-9469.2007.00585.x) от 2008 г. и Zhou, H.; Александр, Д. и Ланге, К. «Квазиньютоновское ускорение для многомерных алгоритмов оптимизации» (dx.doi.org/10.1007/s11222-009).-9166-3) от 2011 года. Я только что узнал о второй статье, и, похоже, она сильно пересекается с методом, который я вывел. Надеюсь, мы проясним этот вопрос!

    презентации класса 3 мая в 3:00

    привет всем — во вторник у нас не будет нормальной групповой встречи. вместо этого
    студентов моего класса будут делать презентации о проектах, над которыми они работали в этом семестре. названия докладов здесь:
    http://www.stat.columbia. edu/~liam/teaching/neurostat-spr11/talks.txt

    презентации начнутся в 3, и каждая должна длиться около 15 минут.
    добро пожаловать всем — надеюсь увидеть вас там.
    л

    Цзянин Ши : 26 апреля.

    Метод оптимального градиента Нестерова я обсужу на собрании группы. Я расскажу о методе Нестерова для минимизации сложной целевой функции, а также о его значении для минимизации L1.

    Рассказа о методе Нестерова, к сожалению, нет, но его работу можно найти на

    http://www.core.ucl.ac.be/~nesterov/


    Красиво сделанные слайды Цзянина можно найти здесь.

    Джонатан Хаггинс : 19 апреля.

    Субмодульность часть II, начало в 17:45.

    После краткого обзора двухнедельной давности я опишу эффективный и полностью комбинаторный алгоритм Кейранна для минимизации симметричных субмодулярных функций. Далее я подробно расскажу о выпуклом расширении Ловаса субмодулярных функций, включая набросок доказательства того, как эффективно вычислять расширение. Наконец, я рассмотрю части недавней статьи Стоббе и Краузе о разложимых субмодулярных функциях, уделяя особое внимание ее применению к марковским случайным полям и связям с расширением Ловаша и вогнутыми функциями 9.2587

    Тим Мачадо : 12 апреля.

    Учебные словари стабильных авторегрессионных моделей для анализа аудиосцен Чо Юнгмин и Лоуренс К. Сол

    Джонатан Хаггинс: 5 апреля

    На этой неделе я буду говорить о субмодульных функциях множеств, обладающих полезным и интуитивно понятным свойством убывающей отдачи. Я начну с определения и приведу множество примеров ситуаций, в которых возникают субмодулярные функции. Я расскажу о некоторых связях с выпуклыми и вогнутыми функциями, а также о стратегиях минимизации и максимизации. В основном я буду опираться на классическую статью «Субмодулярные функции и выпуклость» Ловаша, а также на недавнюю статью Стоббе и Краузе, в которой дается хорошее резюме ключевых результатов, а также обсуждаются многие достижения со времен Ловаша. бумага. Если выступление вызвало у вас интерес, то я настоятельно рекомендую учебник (вместе с часами видео!) Краузе и Гестрина.

    Карл Смит : 22 марта.

    На этой неделе на групповом собрании я представлю недавнюю статью группы Джоша Тененбаума под названием «Моделирование реляционных данных с использованием байесовской кластерной тензорной факторизации», в которой предлагается и исследуется модель реляционных данных, и утверждается, что это удачный компромисс между профессионалами. и минусы методов кластеризации и моделей факторизации. Я планирую представить саму модель, некоторые проблемы, которые она решает, и некоторые результаты, описанные в статье.

    Эйдзабуро Дои: 15 марта.

    Я рассмотрю подробности следующего документа:

    Б. Г. Боргюис, К. П. Ратлифф, Р. Г. Смит, П. Стерлинг и В. Баласубраманян. Дизайн нейронного массива. Journal of Neuroscience, 28:3178–3189, 2008.

    Я бы также упомянул пару связанных статей, в том числе те, которые цитируются в:

    T. E. Holy. «Да! Мы все люди!»: избыточность нейронных цепей. Nature Neuroscience, 13:1306–1307, 2010.

    В основном я планирую вести обсуждение эффективного кодирования, популяционного кодирования, избыточности в нейронных популяциях и кодирования сетчатки. Отчасти потому, что мы заканчиваем черновик журнала по этой теме. Было бы здорово, если бы вы могли принести любые другие документы, которые вы хотели бы обсудить.

    Коля Садеги : 8 марта

    На выставке COSYNE Кадье и Копселл представили интересный плакат о совместных моделях амплитудных и фазовых связей между LFP разных областей. Есть статья об экспериментальных результатах [pdf] [дополнение] и более старые статьи об оценке моделей совместных фазовых взаимодействий [pdf], обе из которых интересны. Модель, включающая амплитуды, пока представлена ​​только на плакатах, поэтому сначала я быстро пройдусь по этим документам.

    Adaptive Compressive Sensing Фрица Зоммера полезно увидеть хотя бы раз, поэтому я быстро пройдусь по нему, если позволит время.

    Адаптивное измерение сжатия

    Фриц Зоммер представил на семинаре COSYNE 2011 волшебные результаты, созданные в соавторстве с Гаем Изели и Кристофером Хилларом.

    Предположим, что какая-то область мозга имеет дело с сигналом, разреженным в каком-то базовом неизвестном словаре. Эта область выполняет субдискретизацию сигнала, например, с помощью случайной матрицы измерений, и отправляет субдискретизированный сигнал в другую область. Принимающая область не знает, какими были исходные сигналы, какой был базовый разрежающий словарь или какая была матрица измерения; все, что он знает, — это полученные им субдискретизированные измерения. Если принимающая область изучает словарь, в котором полученные субдискретизированные сигналы являются разреженными, может ли это разреженное представление также использоваться для линейного представления исходного сигнала? Ответ положительный.

    Чтобы восстановить нормальность и опровергнуть магию, прочтите их статью NIPS. Судя по всему, скоро должна выйти более длинная статья с доказательствами.

    Дэвид Пфау: 22 февраля.

    На этой неделе я представлю классику машинного обучения «Алгоритмы неотрицательной матричной факторизации» Ли и Сына. Это короткая статья, так что вы не будете слишком отвлекаться от подготовки к CoSyNe. Если у меня будет время, я также представлю некоторые части «Онлайн-обучения матричной факторизации и разреженному кодированию» Майрала и др., Так что, если вы так склонны, пожалуйста, прочтите и это.

    студенческий семинар в следующую среду

    для всех, кто заинтересован, Питер Кроста из CUIT расскажет о новом кластерном планировщике (Torque/Maui) на студенческом семинаре в среду, 23 февраля — https://sites.google.com/site/colss1011/

    Алекс Рамирес : 8 февраля.

    Алекс расскажет о: «Спайковые паттерны в ганглиозных клетках сетчатки, необходимые для расшифровки — отчет о проделанной работе».

    Эфтихий: 1 февраля.

    Я рассмотрю следующую статью Махенса: Демиксирование популяционной активности в высших областях коры. Если позволит время, я подробнее расскажу о технических деталях их подхода, описанного в этой статье.

    Новые сообщения Старые сообщения Главная

    Подписаться на: Сообщений (Атом)

    Религий | Бесплатный полнотекстовый | Переосмысление материальной религии на Востоке: ориентализм и религиозная материальная культура в современной западной академической среде

    1. Введение

    кажется, что «восточный мир» привнес в этот интеллектуальный круг более смиренное отношение к пониманию культур за пределами Запада. Тезис Саида об ориентализме заставил западную академию болезненно осознать свои сознательные и подсознательные предположения относительно превосходства Запада над Востоком в последние десятилетия двадцатого века, особенно в дискуссиях о контрасте между христианством и восточными религиями. Несмотря на проблемы, работа Саида положила начало изменению взглядов на наблюдение и понимание Востока в постколониальном контексте. Это заставило ученых на Западе пересмотреть свои предубеждения и отношения власти с Востоком при изучении культур, чуждых их собственной. Основное внимание Саида уделялось западным построениям Востока в контексте ближневосточных исследований, но его идеи также более широко применялись к западным построениям культур Дальнего Востока.

    Тем не менее разумно и резонно спросить, действительно ли мы отступаем от имперского ориентализма. Представления о Востоке сегодня являются следствием более нейтрального и менее экзотичного его восприятия. Ученые Запада пытались использовать Восток для модификации якобы последовательной, но по существу амбивалентной системы знаний на Западе, особенно в сфере сравнительных исследований и религиоведения. Однако я утверждаю, что такие усилия на самом деле создают новый вид «ориентализма», в котором философские, а также космологические концепции сглаживаются и рассматриваются как решение проблем западной эпистемологии. В частности, в новом академическом тренде «Материальная культура» на Западе за последнее десятилетие за повесткой дня объяснения мира в более тонкой, индифферентной и разнообразной манере просматривается новый тип ориентализма. Этот новый тип «ориентализма» создает новый образ Востока и культур вне христианского англо-американского контекста, не как нечто низшее по сравнению с Западом, как в случае традиционного ориентализма, а как бросающий вызов и провоцирующий интеллектуальные рамки Запада. . Этот новый способ понимания Востока, опять же, не представляет того, каким Восток «должен быть», но рождает понимание Востока как того, каким он «должен быть в новом западном нарративе». Эта статья раскрывает этот вид ориентализма путем обзора идей Саида об ориентализме, а также работ и теорий, относящихся к материальной культуре, в современных западных религиоведческих исследованиях, особенно тех, которые касаются китайских религий. Антропологические, философские и исторические исследования по этому вопросу были проанализированы на основе того, как они используют Восток (в этой статье Китай) в качестве рефлексивного инструмента для решения как теоретических, так и интеллектуальных дилемм Запада.

    2. Ориентализм: отражение и понимание

    Так совпало, что в 1970-х годах в Париже и Нью-Йорке возникли два типа противоречивых идей, раскрывающих неизбежную человеческую природу саморефлексии. В Париже Жак Лакан внес новые противоречия и споры в область психологии и когнитивной философии, предложив свои теории о природе человеческого поведения и познания как процесса «отзеркаливания» (Gutting 2001; Lacan [1969] 2007). С психоаналитической точки зрения он пытался показать, что представление человека о себе достигается через узнавание собственного образа в зеркале, и это отражение в зеркале превращает его в объект наблюдения. Таким образом, зеркальная стадия человека одновременно создает образы других в отличие от самого себя; то, что не является частью образа себя, должно быть «другим». Согласно Лакану, человеку свойственно понимать вещи, объекты и людей по отношению к самому себе. Представления людей о «других» являются лишь зеркальным отображением или отражением их понимания самих себя. Основанная на структурной лингвистике Соссюра и фрейдизме, эта теория также широко использовалась для анализа построения культурной идентичности и гендерных ролей в определенных социально-политических контекстах (Inoue 2006). В Нью-Йорке Эдвард Саид предложил аналогичную идею относительно неизбежной человеческой природы саморефлексии и зеркальной автономии, но вместо анализа индивидуальной психологии он нацелился на западную ориенталистскую науку.

    Вдохновленный философией Фуко, Вико, Антонио Грамши и собственным опытом литературной критики, Саид понял, что в художественной литературе, а также в научной литературе о до- и раннем современном западном мире существует своего рода представление Востока. . Под Востоком он в основном имел в виду Ближний Восток и исламский мир, но подразумевал, что то же самое относится и к репрезентации Дальнего Востока (Said 1978). Саид утверждал, что то, как западные интеллектуалы изображали Восток, заключалось в том, что они рассматривали его как явление, объект, который не существует сам по себе, а существует только для западных академических кругов, в этом смысле делая его зеркалом Запада. Во многих сочинениях, как указывал Саид, западные авторы сознательно и бессознательно интерпретировали Восток в соответствии со своими империалистическими интересами. Таким образом, настоящая причина их интереса к Востоку заключалась не в том, чтобы понять Восток ради него самого, а в том, чтобы превратить его в зеркало западной культуры. В такой интерпретации научные работы были такими же вымышленными, как и литературные, хотя их часто называли правдивыми. Такая «литературность», скрытая в «заслуживающих доверия» академических кругах, создала ряд иллюзий о Востоке и кодифицировала это знание, прикрыв это знание академической респектабельностью (Elmarsafy et al. 2013).

    Саид также указал, что такого рода знания, хотя и переплетенные с дарвинизмом, империализмом и геополитикой, были разновидностью ориентализма, существовавшего с эллинистической эпохи. Картледж (1993) показывает, как древнегреческий способ описания истории часто маскировался под манеру «рассказывания исторических фактов», но выражался через сильную «греческую» перспективу. Это означает, что греки всегда осознавали различие между греческим «мы» и варварскими «другими». Весь контекст написания историй «других» коренится в повестке дня определения того, кем были греки, и это отражено в греческих писаниях об истории Востока, особенно персидской и египетской империй (Досса 19).87). Эта антитеза между цивилизованными «нами» и варварским «Востоком» породила классическую форму ориентализма, просуществовавшую в Европе до Нового времени. В частности, катализаторы возникновения ориентализма, с которыми имел дело Саид, были связаны с подъемом и падением Персидской и Османской империй. В серии взлетов и падений восточных империй Саид указывал, что нестабильные отношения между Европой и Востоком заставляли европейских интеллектуалов проводить четкие границы между ними и их соседями не только с точки зрения географических различий, но и в отношении формулирования различий. в своей собственной культурной идентичности (Саид 1978). Он утверждал, что на заре современных западных империй распределение власти между Западом и его восточными колониями превратило эту чувствительную интерпретацию в форму систематизированного знания о Востоке. По словам Саида, кажущееся правдивым знание, предоставляемое западной востоковедной наукой, на самом деле не о Востоке, а о самом Западе. Поэтому Саид смело заявил, что такого рода так называемая нейтральная наука по существу является «политической».

    Принято считать, что в последние десятилетия в западных академических кругах постепенно отказывались от этой явно выраженной формы ориентализма, особенно под влиянием постколониальных теорий, однако постоянный имперский взгляд на Восток по-прежнему неявно сохраняется (Nicha 2012). Конечно, мы вряд ли увидим какие-либо академические работы или заявления, которые открыто противопоставляют Запад и Восток или помещают их в простые бинарные сравнения, как это было в случае с классической формой ориентализма — преувеличение различий между Востоком и Западом и вынесение моральных суждений. Более политизированный культурализм окрашен такими дискурсами, как современность на Востоке, академический нейтралитет и культурный эссенциализм (Paramore 2016). «Нейтрально понимая Восток», западное академическое сообщество по-прежнему должно применять свои академические рамки к культурам Востока и анализировать их на основе новых событий и тенденций на Западе. Таким образом, то, что выделяется в этих репрезентациях Востока, хотя и менее политически низкое и упрощенное, представляет собой сложное «зеркало», отражающее собственные запросы западной академии и интеллектуального мира в отношении их дискурса. Это можно увидеть даже в современных академических дискурсах в странах Восточной Азии для понимания их собственного прошлого до высокой современности. Одним из примеров является школа новой истории Цин в Гарвардском университете, которая пыталась дать новое определение династии Цин (1644–1619 гг.).12) в Китае не как часть китайского общества, а как глобальная династия с чертами, гомогенными остальным китайским династиям (Rawski 1996). Однако сторонники этой школы мысли подверглись резкой критике со стороны ученых в Европе, Америке и Китае, поскольку ориенталистское стремление, которое навязывает новую западную академическую тенденцию глобализма китайской истории, игнорирует очевидные текстовые факты, которые жизненно важны для изучения этой истории. периода в Китае (Ding and Ou 2013). Здесь мы сталкиваемся с «неоориентализмом», в котором Восток больше не презирается, не искажается и не уплощается, а многогранен, нюансирован и сложен. В новейшей западной академии Восток изображался как нечто, стоящее «вне» старых имперских рамок. Тем не менее, это преднамеренное усложнение Востока является результатом смещения западного интеллектуального дискурса, а «многогранный» Восток выдвигается на первый план и даже преувеличивается в этом постколониальном контексте — неоориентализме.

    3. Новый интерес к материальному миру в западных академических кругах

    За последние несколько десятилетий в западных академических кругах возникла новая научная область под названием «Материальная культура», наряду с дальнейшим развитием и трансформацией ориентализма. Интерес к пониманию материального мира и отношений между человеком и объектом привел к бурно развивающейся области теоретизирования и концептуализации «материала» в современных социальных, культурных и философских теориях. Пьер Бурдье ([1979] 1987) был, пожалуй, первым, кто подчеркнул важность материальной жизни человека для понимания процессов социальной стратификации и классификации. Он утверждал, что различные вкусы людей в отношении материальных объектов и способы обращения с ними, основанные на их различном социальном положении, превратили материальные объекты в «культурный/символический капитал», который усилил социальные различия между разными классами. Альфред Гелл (1998) развил это представление о культурно-символических функциях материальных объектов и указал, что материальные объекты, особенно произведения искусства и религиозные идолы, играют важную роль в межчеловеческих коммуникациях. У них есть своего рода «агентство», созданное людьми, создавшими эти объекты. В этом смысле материальный объект может «действовать» и оказывать влияние на социальную жизнь людей. На такой теоретический интерес к взаимосвязи между материальными объектами и культурой также повлияла современная археология, которая долгое время рассматривалась как дисциплина, воссоздающая культуры прошлых цивилизаций и древности на основе тщательного изучения раскопанных материальных объектов (Патнаик 19). 95). Это означает, что западные ученые часто практикуют археологию как имперское предприятие с сильной и явной «ориенталистской» повесткой дня (Hull 2014).

    Феноменология Мерло-Понти также инициировала продолжающуюся дискуссию об отношениях между человеческим телом и материальным миром. Типичный подход Мерло-Понта рассматривает человеческое тело как основу человеческого существования и наиболее важное и эффективное средство социального взаимодействия. Тело и телесные переживания человека рассматриваются как наиболее важная среда для когнитивного процесса (Merleau-Ponty 2002). Это означает, что производство философии, построение понятий и сама культура в человеческом обществе являются физическими и эмпирическими (Tilley 2004). Из-за этого интеллектуалы не могут не обращать внимания на роль материальных объектов и их силу в осмыслении как ментального, так и физического существования человека. Хотя физические переживания и различные культурные представления о материальном мире субъективны и индивидуальны, процесс понимания мира через само тело универсален. Такая идея стимулировала множество новых направлений в западной академии к переоценке прежней эпистемологии и противоречий между объективностью и субъективностью в философии науки, материализма и культуры.

    Современные исследования в области материальной культуры содержат два различных типа понимания отношений между человеком и материальным объектом. Один из них состоит в том, чтобы рассматривать материальные объекты как созданные людьми и «социализированные» в их взаимодействии с человеческим миром, и это было разработано на основе теории Гелла о конструируемой деятельности в материальных объектах. Этот взгляд рассматривает человеческую деятельность как источник силы материальных объектов в изменении человеческой социальной жизни и делает материальные объекты чистым «холстом» для культурных конструкций (Miller 2005). Несмотря на акцент на роли материальных объектов в жизни человека, эта точка зрения по-прежнему ограничивает материальные объекты тем, что они являются объектами человеческого влияния. Таким образом, объекты могут быть поняты только как полностью социализированные, окультуренные и даже морализированные (Арджун [1986] 2012). Другое понимание определяет материальные объекты как автономные, агентные и активные сущности сами по себе, постоянно преобразующие человеческое общество и разум своей собственной силой (Boivin 2008). Другими словами, материальные объекты формируют человеческий разум, поведение и культуру, получая человеческие конструкции и модификации. Таким образом, люди и материальные объекты постоянно существуют во взаимном влиянии и ассоциации. Французский философ и антрополог Бруно Латур выдвигает идею о том, что человек и материальные объекты широко связаны друг с другом, и невозможно различить, кто является объектом, а кто субъектом в таких отношениях (Латур 2010). Основываясь на своих сравнительных исследованиях местных африканских религий и современной европейской/христианской иконоборческой культуры, Латур утверждает, что современное светское общество не очень далеко от традиционного общества, в котором религиозная жизнь доминировала над всем. И религия, и современная экономика представляют собой различные типы «социальных сетей», внутри которых связаны люди и остальной материальный мир. Вся тенденция материальной культуры — это реформа западных эпистемологических, а также теоретических рамок, совершающая поворот от людей и человеческого разума к их зеркальному отражению — материальному миру. Наблюдения за другими культурными и социальными явлениями за пределами Запада используются в качестве доказательства соответствия этой реформе интеллектуального дискурса.

    4. Материальная религия: «Неоориентализм»

    Хотя можно сказать, что традиционный ориентализм, а именно вера в превосходство Запада и иллюзорное восприятие Востока в западной ориенталистской науке, исправлен, это не конец истории. За счет переосмысления Востока (если такое определение действительно существует) и переопределения Запада в последние годы возникла и развивалась новая форма ориентализма наряду с переходом востоковедения на Западе к более «скромному» и якобы «реалистичному» Посмотреть. Во многих случаях экзотические культуры и философии воспринимаются как удобное и быстрое решение или объяснение противоречий сомнительных понятий западной культуры, таких как противоречия между культурой и природой, личностью и материальностью и т.д. Цена этого заключается в том, что мир часто изображается с несколькими независимыми и «монолитными» цивилизациями, каждая из которых представляет ярко выраженную и связную культурную систему. Одной из самых известных работ, представляющих этот плюрализм, является работа Сэмюэля Филлипса Хантингтона ([1996] 2002) книга «Столкновение цивилизаций», в которой древний мир описывается как жестокое поле битвы, питаемое конфликтами между различными культурами. Этот плюрализм, который на первый взгляд оставляет у людей впечатление сторонников культурного разнообразия, на самом деле отрицает тот простой факт, что в любой культуре всегда есть противоречия, конфликты и непоследовательность. Более того, разные культурные системы всегда общались и влияли друг на друга, иногда даже конституируя друг друга.

    Многие ученые пытались использовать Восток как интеллектуальный Эдем, утопию, где пробелы и противоречия, существующие в западной эпистемологии, уже примирены или никогда не существовали. Хотя романтизация Востока — явление не новое, в наши дни такого рода романтизация иногда маскируется под «альтернативную модель мышления». С этой целью в материальной культуре создаются многочисленные редукционистские интерпретации. Одна из работ французского синолога Франсуа Жюльена (1995) на китайском слове ши 勢, которое можно перевести как конфигурация вещей или склонность предметов и жизни, проявил такую ​​склонность. В этой книге, переведенной с французского как «Склонность вещей: к истории эффективности в Китае», он изображает идею склонности в древнекитайской философии и религии как примирение между динамичным и статичным, формой и содержанием, жизнью и небытием. -жизнь, слово и образ, манипулирование и легитимная власть, духовность и материальность. Он утверждает, что концепция ши, которая используется для описания конфигураций армии на поле боя, высших и низших политических влияний, телодвижений, колебаний пейзажей, стилей каллиграфии, изобразительного искусства и литературы, а также движения истории, представляет собой идеальную методологию для западных мыслителей, чтобы справиться с расколами между противоречивыми концепциями в их культуре. Он постоянно напоминает своим читателям, что китайская культура подчеркивает однородность разных вещей — потенциальность и взаимосвязь оппозиций, — которые могут бросить вызов некоторым западным категориям, которые служили основой для западной мысли, но теперь перестали быть актуальными. Он полагает, что, исследуя этимологическое развитие слова ши в китайской материальной культуре, западные ученые узнают об известном предубеждении в западной философии, чья «традиционная» природа, рассматриваемая теперь извне, также будет казаться более заметной по контрасту. С этой целью Жюльен описывает ши как монолитную концепцию, которая объединяет каждый аспект социальной и культурной жизни древнего Китая в единую концепцию. Он рассматривает ши как внутренне связную концепцию, которая формирует уникальный китайский образ мышления в отличие от западного. Он не только исходит из того, что семантическое поле этого единственного иероглифа в китайском языке осталось стабильным и неповрежденным, но также пытается овладеть и соединить различные виды словоупотребления в один хорошо интегрированный философский термин. Впоследствии некоторые антропологи позаимствовали эту «захватывающую и новаторскую» концепцию, чтобы построить структуру для объяснения невыразимых ощущений, с которыми человек сталкивается в материальном мире (Miller 2008).

    Такая идеализация экзотической культуры подобна тому, что я намереваюсь определить как «неоориентализм». Для многих ученых и Восток, и Запад представляют собой внутренне непротиворечивые и независимые культурные системы, погруженные в своего рода целостную культуру, где общество можно рассматривать как внутренне связное и обособленное целое. Однако, как выразился Холбраад (2010), такого рода холизм на самом деле представляет собой «уменьшение полноты мира — краткое изложение его наиболее важных частей» (стр. 70) и игнорирует изменчивые и нестабильные аспекты человеческой культуры. При внимательном рассмотрении развития теорий и знаний о материальном мире на Западе легко увидеть, что они далеки от единодушия и последовательности. Продолжаются споры и разногласия по поводу того, что именно является «материальным» в западном контексте (Ingold 2011), не говоря уже о наложении понятия «материальный» на другие культурные контексты. Не признавая разнообразия и сложности одной культуры, как мы можем перейти к другой, чтобы понять обе? Таким образом, мы, с одной стороны, отрекаемся от «самодовольного ориентализма», а с другой — впадаем в «скромное ориентализм». Или, вероятно, даже помимо простой географической дифференциации, это вообще «скромная экзотика». Этот тип ориентализма отличается от своего предшественника, поскольку он охватывает и принимает культурные различия как таковые и пытается нейтрально представлять разные культуры в западном социальном дискурсе и интеллектуальной структуре. Однако это все же отношение власти, навязывание Востоку подогнанных западных культурных категорий.

    Другим примером является исследование Mayfair Yang (2000) похоронных ритуалов «сожжения бумажных денег» (shao zhiqian) в южном Китае с точки зрения «ритуальной экономики». Ян предполагает, что предложение умершим предкам сжечь фальшивые деньги, чтобы получить благословение предков в китайской культуре похорон, является формой гибрида между местной экономикой и западными капиталистическими ценностями, которые выходят за рамки упрощенной и монолитной силы «капитализма», как она обнаружила в Вэньчжоу, Китай. . В самом деле, при условии, что квинтэссенцией капиталистических норм являются рациональное потребление и максимизация прибыли, делающие упор на материализм и утилитаризм, исконная жертва сжигания денег является якобы ритуальной и относительно «иррациональной». То, что Янг ​​называет «экономической гибридностью», есть форма экономики или, поскольку она заимствует критику Бодрийяра и отделяет потребление от капитализма, форма потребления, которая проникает в другие социальные сферы и институты, в иррациональную и алогичную ритуальную жизнь. В эти ритуалы, в свою очередь, проникают социальные силы; иными словами, потребление сосуществует с другими, с религией и ритуалами. Ян говорит:

    При органической гибридизации скрещивание двух пород, штаммов или разновидностей видов животных или растений или двух разных видов или даже родов приводит к диверсификации органических форм. Гибриды воплощают определенные черты обоих родителей, усиливая одни и стирая другие. Поскольку «гибридизация» заключается во взаимном включении различий внутри, она может быть полезной метафорой для понимания определенных процессов экономических взаимодействий. Однако органическая гибридизация предполагает плавное и беспроблемное смешение признаков и не заключает в себе спорные и агонистические черты процесса комбинирования.

    (Ян 2000, стр. 485)

    То, что Ян пытается показать здесь, является теоретическим вызовом западной капиталистической идеологии и этнографической альтернативой идеалистическому пониманию западного общества как ориентированного на прибыль, светского и менее ритуального . Тем не менее, это не является ни истинным представлением западного общества, ни точным изображением «иностранной альтернативы», которую она предлагает. Несмотря на англо-американскую капиталистическую идеологию, экономическая и материальная жизнь в западном обществе в высшей степени ритуальна, «незападна» и изменчива (Arjun 2013). Эта концепция гибридности, предполагающая, что ритуал сжигания денег является результатом встречи местной китайской похоронной культуры с западным капиталистическим вторжением, не годится для объяснения ритуального жертвоприношения, существовавшего на протяжении столетий до систематических столкновений между Китаем и Западом. Ву 2012). Такое понимание материальной культуры в китайской религии еще раз демонстрирует авторскую повестку дня, которая направлена ​​не на объяснение целевого культурного феномена ради него самого, а на обновление теорий в западном академическом дискурсе. Это означает, что, хотя Восток больше не изображается как нечто неполноценное и «варварское», он все же конструируется как образ Запада. Этот релятивизм означает, что Восток нюансирован и сложен в соответствии с усложнениями западной линзы, используемой для наблюдения за ним.

    Кроме того, проблематично отождествлять англо-американское понятие «материал» с любыми якобы подобными понятиями в других культурах. Материальные объекты понимаются в евро-американском академическом контексте как изначально внешние по отношению к человеческому миру, а затем инкорпорированные в общество (Dant 1999). Это означает, что исследования и концептуализация материальных объектов в области материальной культуры уходят корнями в презумпцию того, что материальные объекты всегда были врожденно гетерогенны для жизни человека. Поскольку они являются внешними по отношению к человеку, странными и неодушевленными, они могут быть предметом человеческого восприятия. Таким образом, идея «материальности» указывает на то, что материальные свойства объектов различны и отделены от их социального существования (Ingold 2011). Этот «культ» материальной культуры, по выражению Инсолла (2009 г.) предполагает, не сводится к каким-то объективным сущностям, лежащим в материальном мире, что может быть понято как «универсальная общая основа» человеческого существования, а представляет собой символический и рефлексивный теоретический инструмент, сконструированный западными учеными. Тогда возникает вопрос, правомерно ли эссенциализировать различные культурные и особенно религиозные явления через призму материальной культуры. Одним из примеров является китайское понятие у, которое часто переводится и концептуализируется в английском контексте как «материал». Но китайская семантика, а также философский контекст этого термина сильно отличаются от того, что ученые считают само собой разумеющимся.

    В ранней этимологической работе «Обсуждая слова и анализ символов» (Shuowen jiezi) (60–122), написанной Сюй Шэнем (1963), объяснение этого символа выглядит следующим образом:

    Ву: [Это означает] мириады существ (ванву). Бык — большое существо. Числа неба и земли начинаются с ведения быка. Таким образом, символ следует за радикалом ox, niu.

    (стр. 30)

    Роэл Стеркс (Roel Sterckx, 2002) отмечает, что объяснение в Shuowen jiezi проводит аналогию между концепцией у как «знаменателя неопределенных «вещей» и телесностью быка, объемлющего и большого по размеру» (стр. 17). Он также замечает, что астрологический аспект «ведения быка» сравнивается со значением у как «явления» в целом. Возможно, концепция у Сюй Шэня была получена из гораздо более раннего использования этого термина для обозначения животных, принесенных в жертву в поклонении предкам и шаманских ритуалах. Цинский ученый Дуань Юцай (1981) в своем комментарии к «Шуовэнь» указывает, что то, что Сюй Шэнь имел в виду под «ведением быка», вероятно, было не настоящим быком, а созвездием Быка (ниу) на небе как первым знаком зодиака в новом году согласно к календарю Чжоу, что может быть связано с поклонением быку. Этот комментарий к у как к «мириадам существ» явно включает в себя сущности и явления материального мира, независимо от того, находится ли он в природной или социальной сфере, в этом единственном персонаже. Подобное толкование можно найти в главе «Достижение жизни» (Дашэн) в «Чжуанцзы»: «Что есть у, то то, что имеет вид, образ, звук и цвет». (Чжуан 1993, с. 114) Более того, в более поздней лингвистической книге под названием «Нефритовые главы (юпянь)» (519–581), составленной Гу Юангом (1983), иероглиф «у» определяется как все, что существует между небом и землей.

    Эти интерпретации иероглифа у, или «объект», показывают, что в отличие от определенных типов общепринятых представлений о природе и материальном мире раннее китайское понятие объекта относилось ко всем видам различных вещей, существ и явлений. без различия живого и неживого. Вероятно, мы можем заключить, что на семантическом уровне диапазон у ближе к идее среды. Все, что окружает человека, можно назвать у. Эта точка зрения также предполагает, что в отношении ву, якобы статических и неподвижных «материальных» объектов, кажущихся активированными и одушевленными объектами, а также явлениями в движении, они одинаковы по своей фундаментальной природе. Опять же, в обоих философских текстах «Лао-цзы» и «Чжуан-цзы» упоминается преобразованная версия у, называемая хуа, что указывает на то, что мириады явлений в этом мире претерпевают непрерывные преобразования. Согласно этим текстам, мудрый царь всегда должен уметь улавливать и поддерживать принципы такой трансформации — Путь (дао) как высшую сущность в китайской космологии (Лао 19).93; Чжуан 1993). Все у в этом материальном мире взаимозаменяемы и изначально связаны ци, которая действует как осязаемый посредник, а также основной материал, из которого был создан мир. Ци играет ключевую роль в этом преобразовании, поскольку именно изменение ци превращает один объект в другой (Lin 2009).

    Другой выдающийся и важный аспект понятия ву заключается в видимости так называемого «материального мира», его способности видеть люди. Другими словами, можно ли назвать объект ву в этом контексте, зависит от его способности быть увиденным людьми, а природа человека и ву всегда рассматриваются как отражение друг друга. Эта идея присутствует в исторических записях, сохранившихся в Цзочжуане и датированных 722 г. до н.э. Он называется «Граф Цзанси протестует, увидев рыбу» (Zangxibo jian guanyu). В этом тексте граф Цзанси предупредил царя, что его обязанность — собирать физические предметы только для того, чтобы показать их выражение (ичжан уцай) (цзо 19).81). Эта обязанность царя также называется «у» и, согласно тексту, является жизненно важным компонентом поддержания надлежащего социального, а также космологического порядка. Ли Югуан (2010) утверждает, что, исходя из философии у со времен Воюющих царств Годянь (476–221 до н.э.) бамбуковых полосок, раннее китайское мышление подчеркивало видимость у как откровения мира для людей, и этот оттенок Ву передается по наследству. Подобные идеи также можно найти в философии Чжу Си в династии Сун (960–1279).

    Долгое время в западных академических кругах этот тип мышления назывался «анимизмом» на Востоке и в Африке и понимался как зеркальное отражение материальной культуры на Западе, которая рассматривает объекты как неодушевленные. Широко признано, что дихотомия между одушевленными и неодушевленными объектами в человеческом познании если и не вытекает прямо из антропологической теории «анимизма», то находится под ее сильным влиянием. Первоначальное обсуждение и определение термина «анимизм», предложенное Э. Б. Тайлором в конце XIX в.века, уже давно подвергались критике как редукционистский и упрощенный способ анализа преобладающего анимизма в традиционных обществах за пределами западного мира. Рассматривая этот анимизм как «примитивную» логику, Тайлор ([1871] 2010) установил четкую границу между современным и «примитивным» образом мышления. Он считал, что различение живых и неодушевленных объектов в современном мозгу является результатом эволюции; тогда как в традиционных обществах считается, что человеческий дух способен владеть материальными вещами и приобретать одушевленную силу. С тех пор фундаментальная логика его теории анимизма подвергалась нападкам со стороны многих ученых, и в результате возникла точка зрения, согласно которой анимизм рассматривался как альтернативный способ мышления, а не как фаза эволюции, позволяющая людям строить социальные отношения между людьми, обществом. , и материальный мир (Берд-Дэвид 1999).

    Джон Кишник (2003) указывает, что в китайском контексте, независимо от того, как люди его называли, этот вид «анимизма», особенно в отношении китайского буддизма, действительно является вопросом «восприятия», а не неразвитого менталитета. . Иными словами, анимистический образ мышления не обязательно эволюционирует в западный смысл научного мышления, и его обоснованность в основном заключается в разумной логике коренных народов, вытекающей из их наблюдения и понимания вещей. Что уместно здесь, несмотря на сложность анимизма, так это то, что категория «неодушевленные объекты» в этом разделе относится к типу вещей, которые являются неорганическими, неодушевленными только в современном сознании, и что этот термин был принят только для ради культурного перевода. Тем не менее, он находится в полной противоположности концептуализации неодушевленных объектов в современном уме. В китайской физиогномике неодушевленных предметов, в частности материальных вещей, эти предметы считаются одушевленными и даже антропоморфными. Поэтому то, что современные ученые называют «материальным» в разных культурах, далеко от реальности «материальной культуры» в разных социальных, а также культурных контекстах, поскольку западного понятия «материал» может даже не существовать. Космологические различия в понимании человеческих реалий в разных геокультурных регионах подразумевают, что даже фундаментальные когнитивные инструменты для конкретного общества или социальной общности не применимы к другому. Китайское представление об у включает в себя как одушевленные, так и неодушевленные объекты, природные и социальные явления, тогда как англо-американское понятие «материал» больше ограничивается неодушевленными и статическими вещами, внешними по отношению к человеческому обществу. Осмысливая другие культуры в западных рамках, «другие» культуры представляются как саморефлексивный инструмент для крайне политизированных программ.

    Еще одна проблема, связанная с существующим ориентализмом в китаеведении, — это собственная современность азиатских обществ, таких как Китай. Ариф Дирлик (Dirlik 1996) уже указывал, что результатом частого и обширного общения азиатских/китайских интеллектуалов с европейско-американскими учеными в наши дни является то, что китайские интеллектуалы усваивают евро-американские идеи и концептуальные рамки для эссенциализации так называемых называют «культурными особенностями» Китая. Очевидно, что в производстве такого рода знаний имеет место игра власти, поскольку местные ученые явно принимают более «высшие» культурные категории Запада и пытаются таким же образом представить свою культурную реальность, реальность, которая имеет смысл только в евроамериканские рамки. Из-за этого подозрительна даже попытка нейтрального объяснения китайской культуры, поскольку эта нейтральность конструируется в рамках новой формы ориентализма, который навязывает евро-американский академический дискурс культурным «другим». Даниэль Вукович (Vukovich 2013) наглядно показывает, насколько предвзятыми были китайские ученые при написании истории эпохи Мао из-за того, что они восприняли западные знания о государстве и политике. Поэтому мы должны осознавать, что классическая форма ориентализма изменилась. Речь идет уже не об упрощенном различении «нас» и «других», а об одновременной релятивизации и универсализации культурных «других», что проистекает из желания приспособиться к академическому, интеллектуальному и идеологическому дискурсу в Запад. Более того, эта новая форма ориенталистского академического сообщества начала приниматься и институционализироваться местными учеными и интеллектуалами за пределами Запада, что привело к глобальному консенсусу в отношении рамок понимания культур.

    5. Помимо ориентализма или просто вопроса культурного перевода

    Как выразился Ллойд (2007), имеет место общепринятое «неправильное толкование» того, как западная академия представляет другие культуры и соотносит их с Западом. Эта условность не просто отражается в неправильном понимании и неправильном переводе различных терминов и слов, но заключается в игнорировании основополагающих различий и несовместимости различных космологий и способов мышления. Предприятие «культурного перевода» требует большего, чем просто отождествление западных концепций с теми, которые считаются «похожими» в других культурах, или просто иллюстрирование того, как они отличаются от западных на избыточном уровне. Перевод между культурами должен быть более тонким и осторожным. С одной стороны, это означает, что определение двух культурных феноменов или концептов как «похожих» или «соответствующих» означает, что они должны быть однородными на метаконцептуальном уровне, чтобы их можно было сопоставить как сходные. С другой стороны, заявление о том, что два понятия или явления «различны», также требует более сложного обоснования того, что такого рода различие не возникает из процесса уплощения и унижения Запада. В противном случае это всего лишь гегемонистский способ различения людей. Эми Ли (Li 2015) предполагает, что переводы между культурами, особенно между различными космологическими, а также религиозными текстами, должны основываться на предпосылке, что любой перевод является формой творения. В этом смысле требуется больше академического внимания к тому, что создали сами академические круги при переводе и понимании различных культур и обществ, и как это было достигнуто.

    Другими словами, академический нейтралитет сам по себе является проблемной позицией, требующей корректировки. В качестве реакции на традиционный ориентализм в современных западных академических кругах в интерпретации культур стала преобладать более политически «нейтральная» точка зрения. Но эта нейтральная точка зрения сама по себе является политической реакцией на явную ориенталистскую, а также колониальную науку. Из-за нового постколониального и постимперского социального контекста западного мира западные академические описания Востока и других иностранных культур становятся все более и более чувствительными к осуждающему и упрощающему тону. Однако такая чувствительность не делает современную западную академию более «нейтральной» и менее эгоцентричной. Например, сфера материальной культуры сама по себе является стратегией придания должного значения ранее игнорируемому и второстепенному предмету в западной академии — материальному миру и материальным объектам. Это согласуется с общей академической тенденцией последних десятилетий заново открывать игнорируемые и деградировавшие предметы в западной имперской академии. Таким образом, были выделены и даже сконструированы многие новые темы и теоретические рамки не на основе «нейтрального» наблюдения за Востоком или какой-либо другой культурой, а целенаправленно отобранных культур, основанных на новых культурных категориях, созданных на Западе.

    Следуя этой логике, можно заключить, что ориентализм является результатом игнорирования эпистемологического парадокса (или предела): можем ли мы действительно знать других, не слишком осознавая себя? Следуя логике, упомянутой выше, решение никогда не должно заключаться в устранении субъективности в понимании других культур, потому что оно никогда не может быть устранено и не должно быть продолжением такого предубеждения. Признание субъективности понимания Запада и Востока и элемента субъективного творчества может быть началом. Сосредоточившись на том, что было создано, и на собственных саморефлексивных конструкциях западного академического дискурса, сравнительные исследования между Востоком и Западом в западных академических кругах должны начинаться с обновленного понимания самого Запада. Знание политической позиции западной академии означает, что всегда следует осознавать преобразующую силу академических интерпретаций культур. Другими словами, академическое сообщество само по себе является «культурой на практике», и, как утверждает Салинс (2005), это создает новые условия для человеческого существования. В настоящее время западное научное сообщество постоянно подчеркивает важность представления «истинного» лица различных культур и обществ, рассматривая все культуры как морально равные и постоянно корректируя свои подходы в соответствии с новыми ситуациями. Тем не менее, даже несмотря на то, что это изменение отношения помогает людям признать субъективность в научных наблюдениях за культурами, оно по-прежнему игнорирует соотношение сил между Западом и другим. В «фуко» смысле производство знания является одновременно производством власти, а академическая нейтральность и «объективность» по-прежнему означают отрицание самоусиливающего процесса производства знания в западной академии. Таким образом, не субъективность является причиной предвзятости, а власть (Фуко [1977] 1980). Поэтому центральным вопросом для Фуко является не относительность утверждения или формы знания, а то, что управляет этой относительностью. В этом смысле власть отвечает только за себя, а «объективное» утверждение отвечает только власти, а не субъектам наблюдения. Напротив, в заключительной главе книги Эдварда Саида (Саид, 1981) в книге «Покрытие ислама» он предлагает всем толкователям культуры осознавать, что они несут ответственность не только за себя и свою собственную культуру, но и должны быть готовы ответить «другим». .

    В частности, в случае религиоведения, религия по-прежнему рассматривается как автономная, отличительная и институциональная сущность в большинстве академических работ на Западе сегодня. Тем не менее, Латур (2002) указал, что этот модернистский идеал в религиозной науке должен быть поставлен под сомнение, поскольку даже то, что в традиционном европейском обществе называлось «религией» или «Богом», на самом деле было чем-то более всеобъемлющим, взаимозависимым и всеобъемлющим. То, что мы сегодня называем «Богом», относится к иудо-европейскому божеству, материализованному в христианской церкви, а то, что средневековый священник называл «Богом», относится к теологической, а также космологической концепции высшего существования. Это навязывание современных представлений о собственной религиозной истории Европы, схема власти, создающая превосходство современности над прошлым. Нюансы различных значений «Бога» в разные периоды не способны сами по себе вызывать предубеждения, но политические предпочтения различных значений могут делать это под предлогом представления реальности. Таким образом, прежде чем переводить религии в различных обществах, мы должны более тонко и комплексно перевести саму «религию». Эти объяснения своих позиций всегда требуются до того, как будет предпринято фактическое сравнение. В противном случае мы только создаем еще больше вводящих в заблуждение категорий, которые в какой-то степени фикционируют культуру. Здесь подход заключается в том, что вместо того, чтобы монотонно поддерживать одну точку зрения в ущерб другой или критиковать то, что считается «неправильным» в господствующем интеллектуальном дискурсе, мы должны быть в состоянии увидеть линию производства знания и ответить любому, кто попытается исследовать такую ​​точку зрения. родословная. Именно это осознание полной картины исторического, а также контекстуального фона концепций, культуры и знаний позволяет проводить действительно тонкое сравнение между различными обществами.

    6. Выводы

    Переводы между концепциями и культурами всегда были трудным делом. В последние десятилетия Восток описывался, понимался и анализировался западными академическими кругами и интеллектуальным дискурсом как плоский образ Запада, зеркало западной цивилизации, экзотический и низший объект. Со времен Эдварда Саида от этой точки зрения постепенно отказались и заменили ее постколониальным подходом. Восток и остальные культуры за пределами Запада следует понимать нейтрально и изображать в соответствии с их собственными реалиями. Тем не менее, в этом пересмотре подхода сохраняется «ориентализм», который усложняет Восток не ради самого себя, а для отражения изменений в западном интеллектуальном дискурсе. Особенно это проявляется в тенденции материальной культуры на Западе, которая часто рассматривается как важный интеллектуальный переход от гуманизма к его противоположности — материальному миру.